KEGG   Thermoanaerobacter wiegelii: Thewi_0493Help
Entry
Thewi_0493        CDS       T01607                                 

Definition
(GenBank) peptidase M42 family protein
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
508216..509235
Genome map
AA seq 339 aa AA seqDB search
MLLKELTELLGASGDEKEVREKIREIVKPYVDEIYVDRIGNLIACKKGKKEKPKVMLAAH
MDEVALMVKSVNEDGTLSFSPVGGVDNRILVAKAVKVGEKKINGVIGAKPIHLQKKGEQE
KPLDFHELYIDIGAASKEEALKHVSPGDYVYFESNFELLGDGYVKAKALDDRIGCNVLIE
ILKNTYEYPVCTAFTVQEEVGLRGAGVAAYNVDPDFAIVVEGTVAADVVDSEPHLVSTEL
GKGPAISLVDRTTLYDRKIIDKIVKIAEKNKIPYQFRRIASGGNDAGKIHITKGGIKTVA
ISVPCRYIHSFDSVANLNDFDNTVKLVDLVIKNIEEVLG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgttattaaaggagttaactgagcttttaggtgcttctggagatgaaaaagaggtaaga
gagaaaataagagaaatagtaaaaccttatgtggatgagatttatgtagacagaattgga
aatttaatagcctgcaaaaaagggaaaaaggaaaagccaaaggtgatgctggctgctcac
atggatgaagttgctttaatggtgaagtctgtaaatgaagacgggacattgagtttttct
cccgtgggtggagttgacaaccgtattctggtagccaaagcagtaaaggtaggggagaag
aagataaacggggtaataggtgcaaaacctatacatcttcagaaaaaaggagagcaggaa
aaacctcttgactttcatgaactctatatagacattggagcagcatctaaagaagaagct
ttaaagcacgtttcacccggtgactatgtctactttgaatcaaattttgaacttttgggg
gatggatacgttaaggcaaaggctttagacgacagaataggctgtaacgtgctgatagaa
attctgaagaatacatatgagtatcctgtttgtacagcttttacagttcaagaagaagtt
ggtttaagaggcgcaggtgtagcagcttacaatgtagatcctgattttgcaatagtggta
gaaggcactgtcgctgcagatgttgtggattcagaacctcatttggtttctacagaacta
gggaaaggaccagcgatttcacttgtggatagaaccactttgtatgatagaaagattatc
gataaaatcgtcaagatagcagaaaagaataagataccctatcagtttagaagaatagct
agcggtggtaatgacgcagggaaaattcacattacaaagggaggaataaagacggtagct
atatctgtaccttgcaggtatattcattccttcgattctgtagctaatctgaatgacttt
gataatacagttaaacttgtagacttagtgattaaaaatattgaggaggtattaggatga

DBGET integrated database retrieval system