KEGG   Thermoanaerobacter wiegelii: Thewi_0493Help
Entry
Thewi_0493        CDS       T01607                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Thewi_0493
Enzymes [BR:twi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Thewi_0493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
508216..509235
Genome map
AA seq 339 aa AA seqDB search
MLLKELTELLGASGDEKEVREKIREIVKPYVDEIYVDRIGNLIACKKGKKEKPKVMLAAH
MDEVALMVKSVNEDGTLSFSPVGGVDNRILVAKAVKVGEKKINGVIGAKPIHLQKKGEQE
KPLDFHELYIDIGAASKEEALKHVSPGDYVYFESNFELLGDGYVKAKALDDRIGCNVLIE
ILKNTYEYPVCTAFTVQEEVGLRGAGVAAYNVDPDFAIVVEGTVAADVVDSEPHLVSTEL
GKGPAISLVDRTTLYDRKIIDKIVKIAEKNKIPYQFRRIASGGNDAGKIHITKGGIKTVA
ISVPCRYIHSFDSVANLNDFDNTVKLVDLVIKNIEEVLG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgttattaaaggagttaactgagcttttaggtgcttctggagatgaaaaagaggtaaga
gagaaaataagagaaatagtaaaaccttatgtggatgagatttatgtagacagaattgga
aatttaatagcctgcaaaaaagggaaaaaggaaaagccaaaggtgatgctggctgctcac
atggatgaagttgctttaatggtgaagtctgtaaatgaagacgggacattgagtttttct
cccgtgggtggagttgacaaccgtattctggtagccaaagcagtaaaggtaggggagaag
aagataaacggggtaataggtgcaaaacctatacatcttcagaaaaaaggagagcaggaa
aaacctcttgactttcatgaactctatatagacattggagcagcatctaaagaagaagct
ttaaagcacgtttcacccggtgactatgtctactttgaatcaaattttgaacttttgggg
gatggatacgttaaggcaaaggctttagacgacagaataggctgtaacgtgctgatagaa
attctgaagaatacatatgagtatcctgtttgtacagcttttacagttcaagaagaagtt
ggtttaagaggcgcaggtgtagcagcttacaatgtagatcctgattttgcaatagtggta
gaaggcactgtcgctgcagatgttgtggattcagaacctcatttggtttctacagaacta
gggaaaggaccagcgatttcacttgtggatagaaccactttgtatgatagaaagattatc
gataaaatcgtcaagatagcagaaaagaataagataccctatcagtttagaagaatagct
agcggtggtaatgacgcagggaaaattcacattacaaagggaggaataaagacggtagct
atatctgtaccttgcaggtatattcattccttcgattctgtagctaatctgaatgacttt
gataatacagttaaacttgtagacttagtgattaaaaatattgaggaggtattaggatga

DBGET integrated database retrieval system