KEGG   Thermoanaerobacter wiegelii: Thewi_0494Help
Entry
Thewi_0494        CDS       T01607                                 

Definition
(GenBank) peptidase M42 family protein
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M18 Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AEM77961
JGI: Thewi_0494
UniProt: G2MW73
Position
509232..510215
Genome map
AA seq 327 aa AA seqDB search
MSVNVELIKKLTQAFGHSGSEEKVFEIIKEEVKGFCDEITHDAMGNMICVKKGKGKKIMV
AAHADEIGIMVTHIEEEGFLRFTTIGGVYVEHLVGRRVVFKNGTVGVIGVEHLEDKKDFK
LEKLYIDIGAKDKKEAEELVRIGDSGAFVGEFVEAGDRLVSKAFDDRIGCYVAIEALKNV
KTENELYFVFTVQEEVGLRGATTAAYSINPDFAIAVDVTATGDTPKAKKMAVALGKGAAI
KVMDRSIIVSPSVRDMMIETAKENNIPYQLEILEFGGTDAGAIHLSRGGVPSGVISIPTR
YVHSVSEMVDKRDVEASINLLIKILEK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtaaatgtggaacttataaaaaagctaacacaggcttttggacattcgggaagt
gaggagaaggtttttgagattataaaagaggaagtcaaaggcttttgcgatgaaattact
catgacgcaatgggcaacatgatatgtgtgaaaaagggaaagggcaaaaagataatggtg
gctgctcatgctgatgaaataggcattatggttacgcatattgaagaggaaggcttcttg
aggtttacaacgataggtggcgtttatgtagagcatctggtgggaagaagagttgtgttt
aaaaatggtacagtaggagtgattggagtagaacatttggaagataaaaaggattttaaa
ctagaaaagctttatatagacataggagcaaaggataaaaaagaagctgaagagcttgtc
agaataggagatagtggggcttttgtaggggagtttgtagaagctggagataggttagtc
tccaaagcttttgatgacagaataggttgttatgtagcgattgaagcgctaaaaaacgtg
aagacagaaaatgagctgtattttgtcttcacagtgcaggaagaagtaggtttgagagga
gctactacagccgcttacagtattaatcctgattttgctattgctgttgatgttacagca
acgggagatactcctaaagcgaagaaaatggcggtagctcttggtaaaggcgcagcaata
aaggtgatggataggtcaataattgtgagcccttctgtaagagatatgatgattgaaact
gcgaaagagaacaatattccgtatcagttagagattctagaatttgggggtactgacgca
ggggcaattcacctttcaagagggggagtaccttcaggggtgatttctattcccacaagg
tatgtccacagcgtttcagagatggtggataaaagggatgtagaggcaagtattaacctc
ctgataaaaatactggaaaaataa

DBGET integrated database retrieval system