KEGG   Thermoanaerobacter wiegelii: Thewi_0507Help
Entry
Thewi_0507        CDS       T01607                                 

Definition
(GenBank) glutamate formiminotransferase
  KO
K00603  glutamate formiminotransferase [EC:2.1.2.5]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi00340  Histidine metabolism
twi00670  One carbon pool by folate
twi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Thewi_0507
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Thewi_0507
Enzymes [BR:twi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.5  glutamate formimidoyltransferase
     Thewi_0507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTCD_N FTCD
Motif
Other DBs
NCBI-ProteinID: AEM77969
JGI: Thewi_0507
UniProt: G2MQS0
Position
524779..525675
Genome map
AA seq 298 aa AA seqDB search
MDQIIECVPNFSEGRDQEKIAQLVKEVVSTEGVKLLDYSSDKDHNRTVITFCGDAKGVKE
AAFKLIKKASEIIDMRYHKGEHPRIGATDVVPFIPVKNATMEECIQIAREVGERVGRELN
IPVYLYEEAAITPERKNLENIRRGEYEGFFEKIKQPEWKPDFGPQEMNPKSGATVIGARN
FLIAYNVNLATDNIDIANKIAKAIRFSNGGYRYVKAMGVELKERGIVQVSMNLTDFNKTP
IYRVFETIKAEASRYGVNVIGSEIIGLVPAKALFDVADYYLRIENFSENMVLENRIYE
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggatcagataattgaatgtgtacctaattttagtgaaggaagagaccaagaaaaaata
gcacagcttgtcaaagaagttgtgtcgactgaaggagtaaagcttttggattactcttcc
gataaagaccacaacaggacagttataaccttttgtggagatgcaaagggagtaaaagaa
gcggcttttaagctcattaaaaaagcttcagagataattgatatgaggtaccataaagga
gaacatccgaggattggggcaacagatgtggtgccctttatacctgtgaaaaatgctaca
atggaagaatgtatccaaattgcaagagaagtaggagaaagggttggaagagagcttaat
atacctgtgtatttatatgaagaagctgctataactcctgaaagaaaaaatttagagaat
ataaggcggggagaatatgaaggcttttttgaaaagataaaacagccggaatggaagcca
gactttggtccgcaggagatgaaccccaaaagcggtgcgacagtgattggcgcaagaaat
tttctcattgcctacaatgtcaatcttgctacagacaatattgatatagctaacaaaatt
gctaaagctatccgattttcaaacggcggttaccggtatgtaaaggcgatgggggtggaa
ttaaaagaaagaggaattgtgcaggtgtcgatgaaccttactgattttaataaaacacct
atttacagagtttttgaaacaattaaagcagaagctagtaggtatggggtaaatgttata
ggcagtgaaataatagggcttgtgccagcaaaggctttgtttgatgtggcagattattat
ttaagaatagagaacttttctgaaaatatggttttagaaaacagaatatacgaatga

DBGET integrated database retrieval system