KEGG   Thermoanaerobacter wiegelii: Thewi_0508Help
Entry
Thewi_0508        CDS       T01607                                 

Definition
(GenBank) Imidazolonepropionase
  KO
K01468  
imidazolonepropionase [EC:3.5.2.7]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Histidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Thewi_0508
Enzymes [BR:twi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.7  imidazolonepropionase
     Thewi_0508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
525685..526932
Genome map
AA seq 415 aa AA seqDB search
MEADLLIYNIKKIYTPLGNCPQCGSDMEKIEEIENAYIAIKDGKIVAAGKSPAAISAKEK
IDAKGMIAIPGFVDPHTHLIHYGSRENEVALKLKGYCYVDILKQGGGILSTVNATRNASD
NQLIEKAMKSLDIMLSHGTTTVEVKSGYGLSTEEEIRLLRLMNKLNSISLVDIVPTFLGA
HSIPTEFKENSWGYVDKIINEMIPKVKEENLAEFCDVFCEDGAFDYEQSKKILEEAKKYG
MKLKIHADELTQSGGGELAGILGAVSADHLEEVSEKGIELMKKAGTVGVLLPGVSYFLDR
PYANARKLIEKGLAVALGTDYNPGTSPTENLQLIMSFAYIKMKMSAKEILTAVTLNAACA
IDKGNDIGTIEKGKKADILLIDAPNLDYVMYHFGVNHVNTVIKSKEDKAVVIGVM
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagatttgttaatatacaacattaagaaaatttatacacctcttggcaattgc
ccacaatgtggaagtgacatggaaaagatagaggagattgaaaatgcttacattgcaata
aaagatggaaaaattgtagcggcagggaaatcacctgccgcaatttctgcaaaagaaaaa
attgacgcaaaaggcatgattgcaattcctggatttgtagaccctcatactcatcttata
cattatggctcaagagaaaatgaagtggcacttaaattaaaagggtattgttatgtagac
atattaaagcaaggtggaggaatactttctactgttaatgcaaccagaaatgcttctgat
aaccaattgatagaaaaagctatgaaaagccttgatataatgctatctcatggcactact
actgtagaagtaaaaagtggatatggacttagcacagaagaagagataaggcttttaaga
cttatgaataagcttaattcaatctctcttgtggatattgttcctacttttttaggggct
cattcaatacccacggagtttaaggagaattcttggggatatgttgataaaattataaat
gaaatgattcccaaagtaaaagaggaaaatcttgcagagttttgtgatgttttttgcgaa
gatggagcttttgactatgaacagtctaaaaagatattagaagaggctaaaaagtatgga
atgaaacttaaaattcacgctgatgagttgacacaaagtggtggaggagaattggcggga
atattaggtgctgtaagcgcagatcatcttgaagaggtatctgaaaaaggaattgaactt
atgaaaaaagcaggtactgtaggggtacttcttcctggagtttcttactttttagataga
ccttatgccaatgcaagaaaattaattgaaaaaggtcttgctgtggctcttggtacggat
tacaacccggggacaagccctacagaaaatttacagcttataatgtcttttgcgtatata
aaaatgaaaatgtctgccaaagagattttaactgctgtgactttaaatgcagcttgtgct
attgataagggtaacgatataggaacaatagaaaaagggaaaaaagctgatatactttta
atcgatgcacctaaccttgactatgtgatgtaccattttggagtaaaccatgtaaataca
gtcataaagtctaaagaggataaggcggttgtaattggggtgatgtaa

DBGET integrated database retrieval system