KEGG   Thermoanaerobacter wiegelii: Thewi_0509Help
Entry
Thewi_0509        CDS       T01607                                 

Definition
(GenBank) hypothetical protein
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
526973..527404
Genome map
AA seq 143 aa AA seqDB search
MYSVSEKLTNICKKYNIALVYLFGSQKENALKLLKEEKVVIDDPLTDIDVGIVFLENIEF
MKDRYKIYANVYNEMEEIFKPYKLDLIFLQERHSIFQCEALKGICIYYYSEEFKDAYEMR
ILRRAADFKYVYDKYNEEVLEKY
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgtatagtgtttcagaaaaattaactaatatatgtaaaaaatacaatatcgcattggtg
tatttatttggctcgcaaaaggaaaatgcactaaaattgttgaaagaggaaaaagtagtt
attgacgatccgttgactgatattgatgttggaatagtctttttagaaaatatagaattt
atgaaagatcgatataaaatttatgccaatgtttacaatgaaatggaagagatatttaag
ccatacaaattagacctcatatttttacaagaaaggcattccattttccaatgtgaagct
ttaaagggaatttgcatttattactattcagaagaatttaaagatgcatatgaaatgcga
attttgaggcgtgcagcagatttcaaatatgtctatgataaatacaatgaagaagtttta
gaaaagtattaa

DBGET integrated database retrieval system