KEGG   Thermoanaerobacter wiegelii: Thewi_0860Help
Entry
Thewi_0860        CDS       T01607                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Thewi_0860
   00052 Galactose metabolism
    Thewi_0860
   00500 Starch and sucrose metabolism
    Thewi_0860
   00520 Amino sugar and nucleotide sugar metabolism
    Thewi_0860
Enzymes [BR:twi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Thewi_0860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
895773..896681
Genome map
AA seq 302 aa AA seqDB search
MKIKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAIQSGIEDILIITGRNK
RAIEDHFDKSVELELELKKKKKESLLHLVEDISNMVNIHYIRQKEPKGLGHAIYCARAFV
GNEPFAVLLGDDIVDAEVPVLKQMIEQYERYNCSIIGVQEVPYEDVDKYGIVDSTPIEDR
LYKVNNLVEKPKKEEAPSNIAILGRYIITPRIFEILENTPPGTGGEIQLTDALKTLLNYE
AIYAYNFIGKRYDVGDKLGYLMATVEYALKREDLREPFKRYLLELVDNLTAIEKEAAVTK
VK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaataaaaaaggcgataattccagctgcaggccttggtaccaggtttttacctgct
accaaggctcagcctaaagagatgcttccaattgtggacaaacccactattcagtacata
gttgaagaagcgatacagtcggggatagaggacattcttataataactggcagaaataaa
agagcaatagaagaccattttgataaatctgtggagttggagctggagttaaaaaagaaa
aagaaggaaagccttttacaccttgtagaagatattagcaatatggtaaacattcactat
ataaggcaaaaggaaccaaaaggtttaggacatgctatatactgtgcgagagcatttgtg
ggcaatgaaccctttgctgttcttttaggggatgatatagtagatgcggaagtccctgtt
ttaaagcagatgatagaacaatacgaaaggtacaactgttctattattggggtacaagaa
gtgccgtatgaggatgtagataaatatggtattgttgattctacacctattgaggacaga
ttgtataaggtgaataatctcgtagaaaagcctaaaaaagaagaagctccatcaaatata
gctattctgggaagatatataataacgccaagaatatttgaaatattagaaaacacgcca
ccaggaacaggtggggagatacagcttacagatgctttaaaaactcttttaaattatgaa
gcaatttacgcctataattttattggcaagagatatgatgtaggggataaattaggttac
cttatggcaactgttgagtatgctctgaaaagagaggacttaagggaaccttttaagagg
tatttattagaacttgttgacaatttaacagctatcgaaaaggaggctgcggttacaaaa
gtaaaatag

DBGET integrated database retrieval system