KEGG   Thermoanaerobacter wiegelii: Thewi_1123Help
Entry
Thewi_1123        CDS       T01607                                 

Definition
(GenBank) ROK family protein
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK HTH_24 MarR MarR_2 Fe_dep_repress HTH_27 SMC_ScpB FeoC Phage_rep_O RPA_C HTH_IclR TBPIP HTH_Crp_2 ApoLp-III
Motif
Other DBs
NCBI-ProteinID: AEM78549
JGI: Thewi_1123
UniProt: G2MSF5
Position
1150338..1151483
Genome map
AA seq 381 aa AA seqDB search
MKDYTKGTSGLIKNINKANVLDVIKKMQPISRIEVSKVLKMSKSTISAIVDELIEEGLVI
ENGYGEKGTVGRKPIQLSFNPDARFVIGISVESTNSIGILTNLEGKILKKIKWETGIKEQ
AFNGIVKGIKELTEEDKNIIGIGIGLPGITDIQAGVVDAPGLKWNNFELKKRLREIFNYN
IYVDNSVNYAALGERWIGCCREIENFVLINIGNGIGSGIYVNGTLLRGNSYAAGEVGYMA
IGEDAFERVYSYEDYGYFERKASLSSLVESVSKSLSYVKTMEGVVKEYKKQNPACVQAVS
QFIKNLSMGIANIVSILNPEAIIIGGDILNYEIDIRQELKEKVKRIVPFDFDIKVAQLGE
DASAIGAVADVLLNTNNLILL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagactatactaaaggcacttcagggttaattaaaaatatcaataaagccaatgtt
ttagatgttattaaaaagatgcaacccatatcgagaatagaggtttctaaagttttaaaa
atgagcaaatctactatttctgccattgtagatgagttgattgaagaaggtttggtaata
gaaaatggttacggagaaaaaggtacagtagggagaaagcctatacagctttcttttaat
cctgatgctagatttgttatagggataagtgttgaatctacgaattcgataggaattctg
actaatttagaggggaaaattttgaaaaagataaaatgggaaactggcattaaagaacag
gcttttaatggaattgtgaaagggataaaagaacttactgaggaagataaaaatataata
ggaattggtattggtcttccaggaattacagatatacaagcaggagttgtggatgcaccg
ggactcaaatggaataattttgaattaaagaaaaggctgagggaaatttttaattataac
atctacgtagataacagtgtaaattatgctgcactgggagagagatggattggttgttgc
cgtgaaatagagaattttgtgcttataaacataggaaatggtataggctcgggaatatat
gtaaatggtactttattacgaggcaatagttacgctgcaggggaagtagggtacatggcc
ataggagaggatgcttttgaaagagtttattcttacgaggattatggttattttgaaaga
aaggcttctttgtcttctttagttgaatcagtttctaaaagtttgtcttatgtaaaaact
atggagggtgtagtaaaagaatataaaaaacaaaatcctgcttgtgtacaagctgtatct
caatttattaaaaatttaagcatgggtattgccaatattgtaagtattttaaacccagaa
gcaataataattggaggagacatcctaaactatgaaattgatatacgccaggagttaaag
gagaaagtgaaaaggattgtgccttttgattttgacattaaagtagctcaacttggtgaa
gatgcttctgctattggggcggtagccgatgtgcttttaaatacaaataatttaatttta
ctataa

DBGET integrated database retrieval system