KEGG   Thermoanaerobacter wiegelii: Thewi_1155Help
Entry
Thewi_1155        CDS       T01607                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:twi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1182007..1182570
Genome map
AA seq 187 aa AA seqDB search
MIEYIRGMIEDIGQDYVVIDFMGIGIKVFVPFSTLKVLPSKGNITKLYTYLHMREDGLQI
FGFKTKEELDLFEKLLSVSGVGPKGALSILSVVSIDNFVKAVNVGDYKALTIAPGIGKKT
AERIILELKDKLPKKIVLEGDNNFSNEALEALLALGYTKSEAIYALADITCDSVEEAVKQ
ALKKLMK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgattgagtatattagagggatgattgaagatattggacaagattatgtagtgattgac
tttatgggtataggcataaaggtttttgttccattttctactttgaaagttttaccttct
aaaggaaatataaccaagctttatacatatttacatatgagagaagatggtttacaaatt
tttggctttaaaacaaaagaagagctagatttgtttgagaaattattgtctgtcagtggt
gtagggcctaaaggagctttgtctattttgtccgtggtttctattgataattttgtaaaa
gcagttaacgtaggcgattataaagctcttacgatagctccgggaataggcaagaagact
gctgagagaattattttggaattaaaagataagcttccaaaaaaaatagttttggaaggt
gataataatttttcaaatgaggccttagaagctttattagctttgggttataccaaaagt
gaagctatttatgctttggcagatatcacctgtgatagcgtagaagaagctgtaaagcaa
gctttgaaaaaattaatgaaatag

DBGET integrated database retrieval system