KEGG   Thermoanaerobacter wiegelii: Thewi_1155Help
Entry
Thewi_1155        CDS       T01607                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:twi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Thewi_1155
Enzymes [BR:twi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Thewi_1155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1182007..1182570
Genome map
AA seq 187 aa AA seqDB search
MIEYIRGMIEDIGQDYVVIDFMGIGIKVFVPFSTLKVLPSKGNITKLYTYLHMREDGLQI
FGFKTKEELDLFEKLLSVSGVGPKGALSILSVVSIDNFVKAVNVGDYKALTIAPGIGKKT
AERIILELKDKLPKKIVLEGDNNFSNEALEALLALGYTKSEAIYALADITCDSVEEAVKQ
ALKKLMK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgattgagtatattagagggatgattgaagatattggacaagattatgtagtgattgac
tttatgggtataggcataaaggtttttgttccattttctactttgaaagttttaccttct
aaaggaaatataaccaagctttatacatatttacatatgagagaagatggtttacaaatt
tttggctttaaaacaaaagaagagctagatttgtttgagaaattattgtctgtcagtggt
gtagggcctaaaggagctttgtctattttgtccgtggtttctattgataattttgtaaaa
gcagttaacgtaggcgattataaagctcttacgatagctccgggaataggcaagaagact
gctgagagaattattttggaattaaaagataagcttccaaaaaaaatagttttggaaggt
gataataatttttcaaatgaggccttagaagctttattagctttgggttataccaaaagt
gaagctatttatgctttggcagatatcacctgtgatagcgtagaagaagctgtaaagcaa
gctttgaaaaaattaatgaaatag

DBGET integrated database retrieval system