KEGG   Thermoanaerobacter wiegelii: Thewi_1358Help
Entry
Thewi_1358        CDS       T01607                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi00900  Terpenoid backbone biosynthesis
twi01100  Metabolic pathways
twi01110  Biosynthesis of secondary metabolites
twi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Thewi_1358
Enzymes [BR:twi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Thewi_1358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh NAD_binding_3 DapB_N YajC
Motif
Other DBs
NCBI-ProteinID: AEM78780
JGI: Thewi_1358
UniProt: G2MWN2
Position
complement(1371497..1372645)
Genome map
AA seq 382 aa AA seqDB search
MKKVIILGSTGSIGTQTLDVIKNFRENFEIVGLTAYNNVELLSKQIREFNPKVVAVKDED
KANQLRENLKKNVEILTGSKGLQEIVKYDADLVVVAVEGIAGLIPTVTAIQRGKDIALAN
KEVLVTAGQIVMDLVKKKDITLLPVDSEHSAILQCLRGNDKKEVSRLILTASGGPFRGKK
KEDLRKVTVNEALNHPNWKMGKKITIDSATLMNKGFEVIEAKWLFDISEDKIDVIVHPQS
IIHSMVEYIDGSVIAQLATADMRIPIQYALNYPTRNYINGINFLDFSITTQLTFEKPDLE
TFRCLSLAYEALKIGGTMTTVLNAADEIAVSLFLNKKIEFLQIAEIIEESMKEHNNIQNP
TLDDIINVDKEVKEKIAKKYMR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggtaataattctcggctcaactggttctatcggtacacaaacattagacgta
ataaaaaattttagagaaaattttgaaatagtaggacttacagcttataacaatgtagaa
cttttatcgaaacaaattagagaatttaatcctaaagttgtagcagtaaaagatgaagat
aaagctaaccaattaagggagaatctaaagaaaaatgtcgaaattctaactggcagcaaa
gggcttcaagaaattgtgaagtacgatgccgatttagtggtggtagccgtagaagggatt
gctggccttattccaacagttacagctatccagaggggaaaagatatcgctttagcgaat
aaagaagtacttgtaacagctggacaaattgtgatggatttggtaaaaaagaaggatata
actcttttacctgtagatagtgaacactctgctatactccaatgtttaagaggaaatgac
aaaaaagaagtatctcgattgattttaacagcctctggaggtccttttagggggaagaaa
aaagaagatttgagaaaagtaactgtaaatgaggctctaaatcatcctaattggaaaatg
gggaaaaaaatcacgatagattctgccactttgatgaataaagggtttgaagtaatagaa
gcaaaatggctctttgacatttctgaagataaaattgatgtgattgtgcatccccagagt
ataattcactcaatggtagaatatatagatggtagtgtaattgcacaattggctactgcc
gatatgaggatacctattcagtatgcattaaattatcctactcgcaattacataaatgga
ataaattttttggatttttctattacaactcagctaacttttgaaaaacccgatttagaa
acttttagatgtttgtcgttggcatatgaggctttaaaaattggcggcacgatgactaca
gtgttaaatgcggctgatgaaatagctgtgtcactgtttttaaataaaaaaatagaattt
ttacaaatagctgaaatcatagaggagagcatgaaagaacataataatatacaaaatccc
actttagatgatataataaatgtggataaagaggttaaggaaaaaatagcaaaaaaatat
atgaggtga

DBGET integrated database retrieval system