KEGG   Thermoanaerobacter wiegelii: Thewi_1485Help
Entry
Thewi_1485        CDS       T01607                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Thewi_1485
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Thewi_1485
Enzymes [BR:twi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Thewi_1485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1485884..1486798)
Genome map
AA seq 304 aa AA seqDB search
MDRKDLLGIKDLSKEEILELLDIAKEMKKILNGEKYSQILKGKTVVTIFFEPSTRTRLSF
EMAAKYLGAHYGNIEVATSSVAKGESLIDTIRTVEMMKADVIITRHNMSGAPHLMAKYTD
ASIINAGDGINEHPTQALLDMMTIREKKKSFEGLKVAIIGDIMHSRVARSNIWGLKKMGA
EVRVAGPSTLMPPQIEKMGVKAYYNVEEAIKDADVVMGLRIQLERQKSGLFPSIDEYREY
FGINKERMKLAKADAILMHPGPINRNIEVTSEAANAEYSVIEEQVTNGVAVRMALLKILC
ERRN
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtggatagaaaagacctattaggcattaaggatttatcgaaagaagaaatacttgaactt
ttagacattgcaaaggagatgaaaaaaattctaaatggagaaaaatattcacagatacta
aagggaaagacagttgtgacgatttttttcgaacctagcacgaggacaagactatctttt
gagatggcagcaaagtatttaggcgctcattacggaaatatagaagtggcaaccagcagt
gttgctaaaggggagtctttaatagacaccataaggactgttgagatgatgaaggcggat
gtgataataacaaggcacaacatgagtggagcgccgcatcttatggcaaaatacacagat
gcctctatcataaacgcaggagatggtataaatgaacatcccacccaagccttgttggac
atgatgacaatcagagaaaagaaaaaaagctttgaaggattaaaagtggcgataatagga
gacattatgcacagcagagttgcacggtcaaatatatggggacttaaaaagatgggggcg
gaagtgagagttgcaggcccttccaccttgatgccaccacaaatagaaaagatgggagtt
aaagcttactacaatgtagaagaagctataaaggatgcggatgtagtgatgggactaaga
attcaattggaaaggcaaaaaagtggactattcccatcaattgacgaatacagagaatat
tttgggataaataaagagagaatgaaacttgcaaaagccgatgcgatattgatgcatcca
ggacctataaacagaaatattgaagttacttcagaagcagcaaatgctgagtattctgtc
atagaagaacaggtaacgaatggtgtcgctgtcaggatggcacttttaaaaatactttgt
gaaaggagaaattaa

DBGET integrated database retrieval system