KEGG   Thermoanaerobacter wiegelii: Thewi_1485Help
Entry
Thewi_1485        CDS       T01607                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:twi00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:twi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1485884..1486798)
Genome map
AA seq 304 aa AA seqDB search
MDRKDLLGIKDLSKEEILELLDIAKEMKKILNGEKYSQILKGKTVVTIFFEPSTRTRLSF
EMAAKYLGAHYGNIEVATSSVAKGESLIDTIRTVEMMKADVIITRHNMSGAPHLMAKYTD
ASIINAGDGINEHPTQALLDMMTIREKKKSFEGLKVAIIGDIMHSRVARSNIWGLKKMGA
EVRVAGPSTLMPPQIEKMGVKAYYNVEEAIKDADVVMGLRIQLERQKSGLFPSIDEYREY
FGINKERMKLAKADAILMHPGPINRNIEVTSEAANAEYSVIEEQVTNGVAVRMALLKILC
ERRN
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtggatagaaaagacctattaggcattaaggatttatcgaaagaagaaatacttgaactt
ttagacattgcaaaggagatgaaaaaaattctaaatggagaaaaatattcacagatacta
aagggaaagacagttgtgacgatttttttcgaacctagcacgaggacaagactatctttt
gagatggcagcaaagtatttaggcgctcattacggaaatatagaagtggcaaccagcagt
gttgctaaaggggagtctttaatagacaccataaggactgttgagatgatgaaggcggat
gtgataataacaaggcacaacatgagtggagcgccgcatcttatggcaaaatacacagat
gcctctatcataaacgcaggagatggtataaatgaacatcccacccaagccttgttggac
atgatgacaatcagagaaaagaaaaaaagctttgaaggattaaaagtggcgataatagga
gacattatgcacagcagagttgcacggtcaaatatatggggacttaaaaagatgggggcg
gaagtgagagttgcaggcccttccaccttgatgccaccacaaatagaaaagatgggagtt
aaagcttactacaatgtagaagaagctataaaggatgcggatgtagtgatgggactaaga
attcaattggaaaggcaaaaaagtggactattcccatcaattgacgaatacagagaatat
tttgggataaataaagagagaatgaaacttgcaaaagccgatgcgatattgatgcatcca
ggacctataaacagaaatattgaagttacttcagaagcagcaaatgctgagtattctgtc
atagaagaacaggtaacgaatggtgtcgctgtcaggatggcacttttaaaaatactttgt
gaaaggagaaattaa

DBGET integrated database retrieval system