KEGG   Thermoanaerobacter wiegelii: Thewi_1518Help
Entry
Thewi_1518        CDS       T01607                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thewi_1518
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thewi_1518
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thewi_1518
Enzymes [BR:twi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thewi_1518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1520873..1521661)
Genome map
AA seq 262 aa AA seqDB search
MNRIDKKFEALKGEGRKALITFITAGDPDIETTYDIVLALEEAGSDIIELGIPYSDPLAD
GPTIQASSQRALNKGVKIPDIMKIVEKIRLKSDIPLVYLVYYNSIFKYGIQKFLKESKDV
GIDGLIIPDLPIEERKDISEEADKYDIYLIPLVAPTSKERIKLITENGKGFVYCVSITGV
TGAREDIETDIEEYMKMVSQYTNMPKAIGFGISTPEMAKKLKDFSDGIIVGSALVERIAK
GYNKSEMLQEVKSFVSSLKEVL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaataggattgacaaaaagtttgaagccttaaaaggagaagggcgcaaagccttaata
acctttataacagcgggagacccggatattgagacaacttatgatatagttttggcctta
gaagaagcaggatcggatataatagaactgggaataccttattctgatcccttagctgat
ggacctacaatacaggcttcttcacaaagagctttaaataaaggtgtaaaaattcctgat
ataatgaaaatagtagaaaaaataaggttaaaaagtgatatccctctggtttaccttgtc
tactataactctatattcaaatatggcatacaaaaatttttaaaagagtcaaaagatgta
gggatagatgggcttatcattccagacttgcctattgaagagagaaaagatatttctgaa
gaagcagataaatacgatatttatttaatacctttagtcgctcccacatcaaaagaaaga
ataaaattaatcactgaaaatggcaaaggatttgtatattgcgtatcaattacaggtgtc
acaggagcaagagaagacattgaaactgacattgaagaatatatgaaaatggtctctcaa
tataccaatatgccaaaggcaatagggtttggcatatctactccggagatggcgaaaaaa
ttaaaagattttagtgatgggattattgtagggagtgcccttgtagaaagaattgctaaa
gggtataataaatctgaaatgctgcaggaagttaagagttttgtatccagcttaaaagaa
gtgttatga

DBGET integrated database retrieval system