KEGG   Thermoanaerobacter wiegelii: Thewi_1518Help
Entry
Thewi_1518        CDS       T01607                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi00260  Glycine, serine and threonine metabolism
twi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
twi01100  Metabolic pathways
twi01110  Biosynthesis of secondary metabolites
twi01130  Biosynthesis of antibiotics
twi01230  Biosynthesis of amino acids
Module
twi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thewi_1518
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thewi_1518
Enzymes [BR:twi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thewi_1518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: AEM78933
JGI: Thewi_1518
UniProt: G2MT41
Position
complement(1520873..1521661)
Genome map
AA seq 262 aa AA seqDB search
MNRIDKKFEALKGEGRKALITFITAGDPDIETTYDIVLALEEAGSDIIELGIPYSDPLAD
GPTIQASSQRALNKGVKIPDIMKIVEKIRLKSDIPLVYLVYYNSIFKYGIQKFLKESKDV
GIDGLIIPDLPIEERKDISEEADKYDIYLIPLVAPTSKERIKLITENGKGFVYCVSITGV
TGAREDIETDIEEYMKMVSQYTNMPKAIGFGISTPEMAKKLKDFSDGIIVGSALVERIAK
GYNKSEMLQEVKSFVSSLKEVL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaataggattgacaaaaagtttgaagccttaaaaggagaagggcgcaaagccttaata
acctttataacagcgggagacccggatattgagacaacttatgatatagttttggcctta
gaagaagcaggatcggatataatagaactgggaataccttattctgatcccttagctgat
ggacctacaatacaggcttcttcacaaagagctttaaataaaggtgtaaaaattcctgat
ataatgaaaatagtagaaaaaataaggttaaaaagtgatatccctctggtttaccttgtc
tactataactctatattcaaatatggcatacaaaaatttttaaaagagtcaaaagatgta
gggatagatgggcttatcattccagacttgcctattgaagagagaaaagatatttctgaa
gaagcagataaatacgatatttatttaatacctttagtcgctcccacatcaaaagaaaga
ataaaattaatcactgaaaatggcaaaggatttgtatattgcgtatcaattacaggtgtc
acaggagcaagagaagacattgaaactgacattgaagaatatatgaaaatggtctctcaa
tataccaatatgccaaaggcaatagggtttggcatatctactccggagatggcgaaaaaa
ttaaaagattttagtgatgggattattgtagggagtgcccttgtagaaagaattgctaaa
gggtataataaatctgaaatgctgcaggaagttaagagttttgtatccagcttaaaagaa
gtgttatga

DBGET integrated database retrieval system