KEGG   Thermoanaerobacter wiegelii: Thewi_1519Help
Entry
Thewi_1519        CDS       T01607                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thewi_1519
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thewi_1519
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thewi_1519
Enzymes [BR:twi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thewi_1519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1521658..1522833)
Genome map
AA seq 391 aa AA seqDB search
MSGRFGRFGGQYVPETVMNALIELEREFEKAKQDKDFMEEYRYYLREYSGRPTPLYYAEN
LTKRFGGAKIYLKREDLNHTGAHKINNVLGQILLAKRMNKKRVIAETGAGQHGVATATAA
AMFGMECEIFMGEEDIKRQSLNVFRMKLLGAKVTPVKSGTGTLKDAVNEAIRDWVTNVDN
TFYVMGSVVGPHPYPTMVRDFQRVIGDEAKEQILQKEGRLPDYVIACVGGGSNAMGIFYP
FIEDKEVKLIGVEAAGEGIETGKHAATMAKGSVGVLHGMMTYLLQDEEGRIMPVYSISAG
LDYPGVGPEHAFLKESNRAQYVYATDEEALAAFMDLSQTEGIIPALESAHALAYAMKLAP
NLRKDNIIIVNLSGRGDKDVNTVAKVLGVEL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaagatttggacgttttggaggtcagtatgtgccagagactgtgatgaatgcg
cttatagaattagagagggaatttgaaaaagctaaacaggataaagatttcatggaagaa
tataggtattacttgagggaatattcaggaagacctacacctttgtattatgctgagaat
cttactaaaaggtttggcggggcgaaaatttatctaaagagggaagacctaaaccacaca
ggagcccataaaataaacaacgtattgggacagattttattggcaaaacggatgaataaa
aagagagttatagctgagacaggagcaggacagcatggagtggcaactgctacagctgct
gcaatgtttggaatggaatgcgaaatattcatgggagaagaagatataaaaaggcaatct
ttaaatgtctttagaatgaaacttttaggtgcaaaagtaacaccagtaaaatcagggacg
ggaaccttaaaagatgcagtaaatgaagcaataagagattgggtgacaaatgtagataat
actttttatgtgatgggttctgttgttgggcctcatccttatcctactatggtgagagat
tttcaaagagtaataggggatgaggcaaaagagcaaatacttcaaaaagaaggaagactt
cctgactatgtgattgcttgtgtcggcggaggcagtaatgccatgggaattttctatccc
ttcattgaagataaagaggtaaaattgataggcgtggaagctgcaggtgaaggaattgag
acagggaaacatgcagctacaatggcaaaaggttctgtaggagtattgcacggcatgatg
acttatcttttacaggatgaagaggggagaataatgccagtatactctatatctgcagga
ctggattacccgggggtaggtccagaacatgcctttttaaaagaaagtaatagagctcaa
tatgtatatgcgacagacgaagaagcattggcggcttttatggacttatctcaaacagaa
gggataataccagctttggaaagcgctcacgctttggcatatgctatgaaactggctcca
aatttaaggaaagacaatattatcattgtaaatttgtcaggcagaggagataaagacgta
aatacagttgcgaaagtattgggggtggagttatga

DBGET integrated database retrieval system