KEGG   Thermoanaerobacter wiegelii: Thewi_1609Help
Entry
Thewi_1609        CDS       T01607                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:twi00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:twi00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1607730..1609181)
Genome map
AA seq 483 aa AA seqDB search
MKLIDILKGVNCEIKGDPNIDISGVCYDSRKSKNKYLFIAIKGFKTDGIFYVEEAIKNGA
VAVVTDREIKEYPGITTVLVEDARAAMAKIASNFYNNPTSKLTLIGVTGTNGKTSVTYML
KAILERQNNKVGLVGTIQNMIGDEVIPSVHTTPESLDLQELFSIMVNKGVKYVVMEVSSH
SLALNRVDECEFDIAVFTNLSQDHLDFHQNMEEYAKTKGKLFKMAKSASVINIDDKYSSM
MIESSKAKVLTYGIKDFAYVMAKDIRNSLSGVKFKVQIEDKKEEISLKIPGIFSVYNALA
AITVADFLGISLRSVREALSQVTVKGRFELVETGKDFYVIIDYAHTPDGIQNIMEALKEY
KTGRKILLFGAGGDRDKTKRPLMGEVAGKYADFCILTSDNPRSEDPREIISQIEEGIKKT
NCPYVVIENRKEAISYALTNAQKDDVIILAGKGHETYQIIGDKVIHFDEREIVKEILSEG
GNR
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttatagatattttaaaaggagtcaactgcgagataaaaggagatcctaatata
gacatcagtggggtgtgttacgattcccgtaaatctaaaaataaatatttatttatcgct
ataaaagggtttaaaaccgatggtattttctatgtggaagaggctattaaaaatggggca
gttgctgttgttacagatagggaaataaaagaatatcccggaattacaacagtattagta
gaagatgctcgagctgccatggcaaaaatagcttctaatttttacaataatcccaccagc
aaacttactttaattggtgtaacaggaacaaatggcaaaacctctgttacttatatgcta
aaagcgattttagaaaggcaaaataataaagtgggattagtagggactatacaaaatatg
ataggggatgaagtgataccttctgtacataccacacctgaatcgttggatttgcaggaa
ctttttagtattatggtgaacaaaggtgttaagtatgtggttatggaggtatcatctcat
tctttagcattaaatagagtagacgaatgtgaatttgatatagcagtttttaccaactta
tcccaagaccatttagattttcaccagaacatggaagagtatgctaagacaaagggtaag
ttattcaagatggcgaagagtgcgtcggtcatcaatatagatgataaatactcttctatg
atgattgagagttctaaagcaaaggttttgacttatggtataaaagattttgcttatgtt
atggcaaaggatattaggaatagtctaagcggtgtaaagtttaaagttcagattgaagat
aaaaaagaagagatttcattaaaaattccaggaatttttagcgtctacaatgctttagct
gccattacagtggctgattttcttggcatttctttgcgaagtgtgagagaggctttaagt
caggtcacagtaaaaggtcgatttgaactggtggagacaggaaaagacttttatgtgatt
atagattatgcccatactcctgacggaatacagaatataatggaagccttgaaggaatat
aaaactggaagaaaaatacttcttttcggtgctggaggagatagagataaaactaaaagg
cctttgatgggagaagttgcagggaagtatgcggatttttgcattttgacttcggataat
cctcgttcggaagacccaagagaaataatttcacaaattgaggaaggcataaaaaagact
aattgcccttatgttgtaatagaaaatagaaaagaagcgataagctacgctctgactaat
gctcaaaaagacgatgtaataatacttgcaggtaaaggacacgaaacttatcaaattata
ggagataaggttattcactttgatgagagagaaatagttaaagaaattttgtctgaaggc
ggtaatagatga

DBGET integrated database retrieval system