KEGG   Thermoanaerobacter wiegelii: Thewi_1627Help
Entry
Thewi_1627        CDS       T01607                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thewi_1627
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thewi_1627
   00020 Citrate cycle (TCA cycle)
    Thewi_1627
   00620 Pyruvate metabolism
    Thewi_1627
Enzymes [BR:twi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Thewi_1627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1626126..1627274)
Genome map
AA seq 382 aa AA seqDB search
MPVNVVMPKLGLTMKEGRVDRWLKKVGDIVKKGEEIVEVSTDKITNVVESPADGILAKIL
VNEGEIVPVATPIGIITAEGEKLEEVEKSEEKFIKATPVAKRLAKENNIDLSLITGTGPG
GRITEEDVKKFISEQKVKTEEEGPKKEVAVIEGQALEKVERMPMDNIRKTISQRMKKSWS
EIPHVTEDIKVDVTELVNLRENLNHISDNKFTYTDLIAKACVIAIKKNPVVNWSIEGEYI
IKNSSINLGIAVALDNGLIVPVVKEADKKSLLELSKNIKELSERARNNKLTPDEIIGSTF
TITNLGMYEIDSFTPIINPPESAILGVNKIYKEPVVLDDNIVIRHIMKLSLSFDHRLIDG
ATAAKFLLDLKKTLENPVSLLI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaaatgtagtgatgcctaaattgggacttacaatgaaagaaggcagagtagat
agatggcttaaaaaagttggtgatattgtaaaaaaaggagaagagattgtcgaggtttct
acagataagattaccaatgttgtagaatctccagcggatggaattttggcgaagatctta
gtaaatgaaggagaaattgtaccagtagctactcctattggaataattacagctgaaggg
gaaaagttagaagaagtagaaaaaagtgaggaaaagtttataaaagctactccagtagca
aaaaggttggcgaaggagaataacatagacctttctttaataactggaacaggaccaggt
ggaaggattactgaagaagacgtaaaaaagtttatttctgagcaaaaagtaaaaacagaa
gaagagggaccaaaaaaagaagtagcagtaatagaaggacaagcattggaaaaagttgaa
agaatgccaatggacaatattcgcaaaaccataagtcaaaggatgaaaaaaagctggtca
gaaattcctcatgttacagaagatattaaagtggatgtcacagaactggttaacttaaga
gaaaatttaaatcatattagcgataataaatttacttataccgatttaattgcaaaagca
tgtgtaatagctataaagaaaaatcctgtagttaactggtctatagaaggagaatatata
attaaaaatagcagtataaatctcggaattgcagtggctttagataatggtttaatagtt
cctgtagtgaaagaggcggacaaaaagagtctattagaattgtcaaaaaatataaaagaa
ttaagtgaaagagcgagaaataataagcttactccagacgaaataatcggaagtacattt
actatcactaaccttggaatgtatgaaatagatagtttcacgcctattataaatccgccc
gaaagtgctatattgggtgtcaacaaaatatataaagaaccagttgttctagacgacaat
attgttataaggcatattatgaaacttagcctttcttttgaccatcgattaatagatggg
gctaccgctgctaaatttttgcttgacttaaagaaaacattagagaatccagtatcttta
cttatttaa

DBGET integrated database retrieval system