KEGG   Thermoanaerobacter wiegelii: Thewi_1675Help
Entry
Thewi_1675        CDS       T01607                                 

Definition
(GenBank) dipeptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi00300  Lysine biosynthesis
twi01100  Metabolic pathways
twi01120  Microbial metabolism in diverse environments
twi01230  Biosynthesis of amino acids
Module
twi_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Thewi_1675
Enzymes [BR:twi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Thewi_1675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peroxin-22
Motif
Other DBs
NCBI-ProteinID: AEM79075
JGI: Thewi_1675
UniProt: G2MTR1
Position
complement(1673548..1674942)
Genome map
AA seq 464 aa AA seqDB search
MDLNSYIDNMRDDIIKSVQELVKIKSVQDEPKPGMPYGEGVAKALDKALEIAQSLGFRTK
NVDGYVGYAEYGEGEEMIGVLGHLDVVPEGDGWTYPPYGAEIHDEKIYGRGTVDDKGPII
AALYGLKAIKDAGLKLSKRVRILFGTNEETGSHEIAYYLKHDEAPTMGFTPDAQYPIIYA
EKGITMFNVVKDFNKKSSNIVIKYIKGGERPNVVPGYCEAGLEVKEANKKKEIQDKLEAF
IKETGYNLKAEEKDEMLVIKSVGVSAHGSLPHLGKNAIMQLFLFLDRIDLEDSDVKDFIH
FFATNVGMETDGKTFGIYLKDETGELTFNVGTIQLDENKGVLGLNIRYPVKYKYEDWMNI
FEEKIKTNGMRIEDMLHQPPLYFPPDHPLIKTLSKVYEEQTGQKAELLAIGGGTYAKEMP
NTVAFGPVFPGKPELAHQADEYIEIEDLILNAKIYAHAIYELAK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggatttaaattcctacatagacaatatgagagatgacattataaaatctgttcaagag
ttagtcaagataaaaagcgtacaagatgaaccgaaaccaggaatgccttatggagaaggt
gttgctaaggcattggacaaagctttagagattgcacaaagtttaggctttaggactaaa
aacgtggatggctatgtagggtatgcagaatacggcgaaggagaagaaatgataggagtt
ttgggacatttagatgtagttccagaaggtgatgggtggacttatccaccttatggtgct
gaaatacatgatgaaaagatatatgggagaggtactgtagatgataagggccctataatt
gctgctttatacgggctaaaggctataaaagacgctgggttaaagctttctaaaagagtg
agaattttatttggaacaaatgaagagacaggttctcacgagattgcttattatttaaaa
cacgatgaagctcctacaatgggctttactcctgatgctcaatatccaattatatatgca
gaaaaaggaataacaatgtttaatgtggtaaaagactttaataaaaagtccagcaacatt
gttataaaatacatcaaaggtggagaaaggcctaatgtagtaccaggctattgtgaagct
ggattagaggtaaaagaggcaaataagaagaaagaaattcaagataagttagaagccttc
ataaaagagactggttacaatttgaaggctgaagaaaaagacgaaatgcttgtaatcaaa
tcagtaggggtttcggctcatggcagccttccacacttagggaaaaatgctataatgcag
ctatttctcttccttgacagaatagatttagaggatagcgatgtcaaagattttatacat
ttctttgctacaaatgtgggaatggaaacagatggaaaaacttttgggatatacttaaaa
gatgaaacaggagaattgacttttaacgttggtactattcaattagatgaaaacaaagga
gtattaggattaaatattcgatatcctgtaaaatataaatatgaggattggatgaatatt
tttgaagaaaaaatcaaaactaatgggatgagaatagaagacatgctccatcaaccacct
ttgtatttcccaccagaccatcctttgataaaaactttgagcaaagtttatgaagaacag
acgggacagaaagcagagcttttagcaataggtggaggaacttatgcgaaagagatgcct
aacacagtagcatttgggcctgtttttccaggcaagccagagttagcacatcaagcggat
gaatatatagaaattgaagatttgatattaaatgcaaaaatttatgctcacgctatatat
gaattagcaaaataa

DBGET integrated database retrieval system