KEGG   Thermoanaerobacter wiegelii: Thewi_1687Help
Entry
Thewi_1687        CDS       T01607                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:twi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:twi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:twi00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:twi00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:twi00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1688374..1689144)
Genome map
AA seq 256 aa AA seqDB search
MISKGVFVLRRPIIAGNWKMHMTPSEAVKLVEELIPQVKDAKAEVVVIPPFVDLTEVNKV
IQGTNILLGAQDMFWEEKGAYTGEISPLMLKEIGVKYVVIGHSERRQYFGETDEMVNKKV
LSALSHGLSPIVCVGESLSQREEGKTFEVVLNQTKEALKGVSHDDIVNVVIAYEPIWAIG
TGKTATAKDANEVIKAIRNTIASLYGKGKASLVRIQYGGSVKPENISELMAESDIDGALV
GGASLVASDFAKIVNY
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgataagtaaaggggtgtttgttttgagaagaccaataattgcaggtaactggaaaatg
cacatgaccccttctgaagcggtgaagttagttgaggaattgatacctcaagtgaaagat
gcaaaagcagaagttgtagtaatacctccttttgtggacttgacagaggtaaataaagta
attcaaggtactaatattcttctcggagcacaagatatgttttgggaagaaaagggcgca
tatacgggggaaatttcacctttaatgcttaaagagattggggtgaaatatgttgtaata
ggccactctgaaagaaggcagtattttggtgagactgatgaaatggtgaataaaaaagtt
ttatccgctctatctcacggcttaagtcctattgtgtgtgtaggagaatctctttctcaa
agagaagaaggaaaaacttttgaagtagttttaaatcaaactaaagaggctttaaaaggt
gtttcccacgatgatattgtaaatgtagtaatagcttatgagccaatttgggctataggt
actggcaaaactgctacagctaaagatgccaatgaagtgataaaagctataaggaatact
atagcttccctttatggaaaaggaaaagcaagtttagttaggatacagtatggggggagt
gtaaagcccgagaacatttctgaactcatggcagagagcgatatagacggggctttagta
gggggagcaagtcttgtagcatcagattttgcaaagattgtcaattattaa

DBGET integrated database retrieval system