KEGG   Thermoanaerobacter wiegelii: Thewi_1687Help
Entry
Thewi_1687        CDS       T01607                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thewi_1687
   01230 Biosynthesis of amino acids
    Thewi_1687
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thewi_1687
   00051 Fructose and mannose metabolism
    Thewi_1687
   00562 Inositol phosphate metabolism
    Thewi_1687
Enzymes [BR:twi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Thewi_1687
Exosome [BR:twi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Thewi_1687
  Exosomal proteins of bladder cancer cells
   Thewi_1687
  Exosomal proteins of melanoma cells
   Thewi_1687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1688374..1689144)
Genome map
AA seq 256 aa AA seqDB search
MISKGVFVLRRPIIAGNWKMHMTPSEAVKLVEELIPQVKDAKAEVVVIPPFVDLTEVNKV
IQGTNILLGAQDMFWEEKGAYTGEISPLMLKEIGVKYVVIGHSERRQYFGETDEMVNKKV
LSALSHGLSPIVCVGESLSQREEGKTFEVVLNQTKEALKGVSHDDIVNVVIAYEPIWAIG
TGKTATAKDANEVIKAIRNTIASLYGKGKASLVRIQYGGSVKPENISELMAESDIDGALV
GGASLVASDFAKIVNY
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgataagtaaaggggtgtttgttttgagaagaccaataattgcaggtaactggaaaatg
cacatgaccccttctgaagcggtgaagttagttgaggaattgatacctcaagtgaaagat
gcaaaagcagaagttgtagtaatacctccttttgtggacttgacagaggtaaataaagta
attcaaggtactaatattcttctcggagcacaagatatgttttgggaagaaaagggcgca
tatacgggggaaatttcacctttaatgcttaaagagattggggtgaaatatgttgtaata
ggccactctgaaagaaggcagtattttggtgagactgatgaaatggtgaataaaaaagtt
ttatccgctctatctcacggcttaagtcctattgtgtgtgtaggagaatctctttctcaa
agagaagaaggaaaaacttttgaagtagttttaaatcaaactaaagaggctttaaaaggt
gtttcccacgatgatattgtaaatgtagtaatagcttatgagccaatttgggctataggt
actggcaaaactgctacagctaaagatgccaatgaagtgataaaagctataaggaatact
atagcttccctttatggaaaaggaaaagcaagtttagttaggatacagtatggggggagt
gtaaagcccgagaacatttctgaactcatggcagagagcgatatagacggggctttagta
gggggagcaagtcttgtagcatcagattttgcaaagattgtcaattattaa

DBGET integrated database retrieval system