KEGG   Thermoanaerobacter wiegelii: Thewi_1787Help
Entry
Thewi_1787        CDS       T01607                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi00010  Glycolysis / Gluconeogenesis
twi00030  Pentose phosphate pathway
twi00051  Fructose and mannose metabolism
twi00052  Galactose metabolism
twi00680  Methane metabolism
twi01100  Metabolic pathways
twi01110  Biosynthesis of secondary metabolites
twi01120  Microbial metabolism in diverse environments
twi01130  Biosynthesis of antibiotics
twi01200  Carbon metabolism
twi01230  Biosynthesis of amino acids
twi03018  RNA degradation
Module
twi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thewi_1787
   00030 Pentose phosphate pathway
    Thewi_1787
   00051 Fructose and mannose metabolism
    Thewi_1787
   00052 Galactose metabolism
    Thewi_1787
  Energy metabolism
   00680 Methane metabolism
    Thewi_1787
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Thewi_1787
Enzymes [BR:twi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Thewi_1787
Protein phosphatases and associated proteins [BR:twi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Thewi_1787
Messenger RNA biogenesis [BR:twi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Thewi_1787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEM79178
JGI: Thewi_1787
UniProt: G2MWR6
Position
complement(1792980..1793945)
Genome map
AA seq 321 aa AA seqDB search
MKTIGILTSGGDAPGMNAAIRAVVRTGIYYGLKVKGIMRGYAGLVEDEVIDLNLSSVGDI
LQKGGTILRTARCEEFKKKEVRKKAYETLQKHGIEGLVVIGGDGSFRGAQLLSEEWNVNT
IGIPGTIDNDIPCTDYTIGFDTACNTVIDAINKIRDTATSHERANIIEVMGRNAGYIALY
AGLAGGAEMIILPEVEWSIDELCDKITYGIKRGKLHHIIVLAEGVMSAPELAKMIKERLP
KLDLRYTILGHIQRGGAPTVMDRVLASQMGARAVELLLENKTKRIISIRNNQIVDDDIDE
ALSMKKEFNRKLYELSKILSI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaattggtatacttacgagtggtggagatgcaccagggatgaacgcagctata
agggctgtggtgaggacaggaatttattatgggcttaaagtaaaaggtattatgagggga
tatgcaggcttagtagaggatgaagttattgacttaaatctttcttcagtaggagatata
ttgcaaaaaggcggtactattttgagaactgctagatgtgaagaatttaagaaaaaagag
gtgcgcaaaaaagcttacgaaacccttcaaaaacatggaatagaaggtctcgttgtaatt
ggaggagatggctcttttagaggagcccagcttttgagtgaagaatggaatgtaaataca
attggaattccaggtacaattgacaatgacataccttgtacagattatacaataggtttt
gatacagcttgtaatactgttattgatgcaataaataaaataagggatactgctacttcc
catgagagagcaaatataatagaagtgatgggaagaaatgcgggttacattgctttgtat
gctggtctagctggtggagcggagatgattatacttcctgaagtggaatggagcatcgat
gaactttgcgataaaattacttacgggataaagagaggaaagcttcatcatataattgtc
cttgcagaaggagttatgagcgctccagaactagcgaaaatgattaaagaaaggctacca
aaattagacttaaggtatactattttggggcacattcaaagaggtggagctcctacagtg
atggatagggtattggcaagccaaatgggagcaagagcagtggagttgcttttggaaaat
aaaactaagaggataataagtatacgaaacaatcaaattgtagacgatgatatagatgaa
gccctttccatgaaaaaggagtttaacagaaaactttatgagctcagcaagatattgtct
atataa

DBGET integrated database retrieval system