KEGG   Thermoanaerobacter wiegelii: Thewi_1893Help
Entry
Thewi_1893        CDS       T01607                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:twi00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:twi00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:twi00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1902423..1904621)
Genome map
AA seq 732 aa AA seqDB search
MAIYYDEKTKTFHLVAKDTSYVVYVSTYGRLFHVYFGKRIKDESTIHLSSEVEKVYVAVV
EQRRNFSFEVMPQEYPAYGNTDFRSPAYQIQLENGSTISDLRYLSHKIYKGKPKLEGLPA
TYVENEDEADTLEIELYDKVANLKVNLIYTAFRDYDVITRSVRFENMGKEDIKLLRALSM
NVDFSDDKFDMLQLSGAWARERHVIRRPLTLGVQSIESRRGASSHQQNPFIALLRKDADE
WHGDVYGFSLVYSGNFLAQVEVDQYKMARVSMGINPFDFSWLLKPGETFQTPEVVMVYSD
SGLNKMSNTYHKLYRNRLMRSKFKDKERPILINNWEATYFDFTEEKLKELAKEAKDLGIE
LFVLDDGWFGKRNSDNSSLGDWFVNKEKIPSGLDGLAKGINSLGLKFGLWMEPEMVSPDS
DLYREHPDWCIHVPNRPRSESRNQLVLDLSRKDVQDYIIKVVSDILESANISYVKWDMNR
NMTEIGSALLPPERQRETAHRYILGLYRILEEITTRFPDVLFESCAGGGGRFDPGMLYYM
PQTWTSDDTDAIERLKIQYGTSIVYPLISMGSHISAVPNHQVNRITPLKIRAHVAMSANF
GFELDLAKLSSEEKEEIKKYVEKYKEIRKLVQFGDFYRLLSPFEGNETAWLIVSEDKREF
LLYYFRVLGGANEPIKRLYLKGIKPDFNYVLEDDNSVYCGDELMYAGIILPELKGDFQSI
MMHFKEESIKDG
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggctatatattatgatgaaaaaacaaaaacgtttcaccttgtagcaaaggatacaagt
tatgtagtatatgtgagtacttatggtcgtctgtttcatgtttattttggcaaaaggata
aaagatgaaagtactattcatttaagttctgaagtagaaaaagtatatgtagcagttgtg
gagcaaaggagaaatttttcatttgaggtaatgcctcaagaatatcctgcgtatggcaat
actgattttagaagtcctgcgtatcaaattcagcttgaaaatggttctactatttctgat
ttaagatacctatctcacaagatctataaaggtaaacctaaattagaagggcttccggct
acttatgttgaaaatgaagatgaagctgatactcttgaaatagagttatatgataaagta
gcaaatttaaaagtaaatttaatttacacggcatttagagattatgatgttatcacaagg
tcagtgagatttgaaaacatgggaaaagaagacataaaattgttaagagctttgtctatg
aatgttgattttagtgatgataagtttgacatgcttcaattgtcaggggcttgggcgaga
gaaagacatgttataagaagaccacttactcttggagttcagtctattgaaagcagaaga
ggtgcaagcagccatcagcaaaatccttttatagcacttttaaggaaagacgctgatgaa
tggcatggagatgtgtatggatttagccttgtttacagtggcaatttcttggcacaagta
gaagtggatcaatataagatggcgagagtctctatgggaattaatccatttgatttttca
tggcttttaaaaccaggtgaaacatttcaaacaccagaagtcgttatggtttattcggat
agtggcttaaataaaatgtcaaatacctatcacaaactgtacagaaatagacttatgaga
agtaaatttaaggacaaagaaagaccaattcttataaacaattgggaagccacttatttt
gattttaccgaagaaaaacttaaagaacttgctaaagaagctaaagatttgggtattgaa
ttgtttgttcttgacgatggatggtttggaaagagaaattctgacaattcttcactggga
gattggtttgtaaataaagaaaagattccaagtggtttggatggccttgcaaaagggata
aattctttaggtttaaaatttggattatggatggaaccagaaatggtgtctcctgatagt
gacctctatagagagcatcccgattggtgtatacatgtacctaataggccgagaagtgaa
agcagaaatcaacttgtattggacttatcacgaaaagatgtacaagattatattataaaa
gtagtgtcagatattttggaaagcgccaacataagttatgtaaaatgggatatgaataga
aatatgacagagataggctctgcacttttgcctcctgaaagacaaagagaaactgctcac
agatatattcttggactttacagaatattagaagaaataacgacaaggtttcctgatgtt
ttgtttgaaagttgtgctggtggtggcggtcgttttgaccctggaatgctttattatatg
ccccagacttggactagtgatgatacagatgcaattgaaagacttaaaatacagtatggt
acaagtatagtttatcctcttatttccatgggaagccacatatctgctgtaccaaatcat
caagttaacagaattacgccgttaaaaatacgtgcacatgtagcaatgtcagctaatttt
ggctttgaacttgatttggcaaaattgagcagtgaagaaaaagaggaaataaagaagtat
gttgagaagtataaagagattaggaaactggtgcaatttggagatttttatcgattgtta
agtccctttgaagggaatgaaactgcttggttgattgtttctgaggataaaagagaattt
ttgctctattattttagagttttgggaggagcaaatgaacctattaaaagactttatcta
aagggaataaaaccagatttcaattatgttttagaagatgataatagtgtatattgtggt
gatgagttaatgtatgcaggaataatacttccagaacttaaaggagattttcagagcatt
atgatgcattttaaggaggagagtattaaagatgggtag

DBGET integrated database retrieval system