KEGG   Thermoanaerobacter wiegelii: Thewi_2009Help
Entry
Thewi_2009        CDS       T01607                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:twi00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2031856..2033349)
Genome map
AA seq 497 aa AA seqDB search
MAKYIMAFDQGTTSSRAIIFDHSGKIVAALNKEFKQIYPKPGWVEHDPMEIWESQIEVAK
GVIEKAGINPEDIAAIGITNQRETTVVWDKNTGKPIYNAIVWQCRRTAPICDELKNKGFD
KKIREKTGLVVDAYFSGTKVKWILDNVEGAREKAEKGELLFGNIDTWLIWNLTRGNVHVT
DYSNASRTMLFNIHELKWDKEILAELNIPEQMLPEVKPSSYVYGYTDKSIFGVEIPIAGD
AGDQQAALFGQACFKPGMAKNTYGTGCFMLMNTGEKAVPSNTGLLTTIAWGIDGKVEYAL
EGSIFIAGAAIQWLRDELRIIDNSPQSEEYALKVEDTNGVYVVPAFVGLGAPYWDMYARG
TIVGLTRGAKREHIIRATLESIAYQTRDVLEAMQEDSGIKLQALKVDGGASANNFLMQFQ
SDILGVPVDRPQVIETTALGASYLAGLAVGFWNSKEEIEKNWNVDKHFEPAMDNEKREKL
YKGWKKAVERAMKWAEE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtacattatggctttcgaccaagggacaacaagttcccgtgcaataattttt
gaccatagcggcaaaattgttgccgcattgaataaggaatttaaacaaatttaccctaag
cctgggtgggtagaacatgacccaatggaaatatgggaatcccaaatagaagttgcaaaa
ggtgttatagaaaaagcgggtattaatccggaggatattgcagctattggcattacaaat
cagagagagacaactgttgtatgggataaaaatacaggaaaacctatttacaatgcaata
gtgtggcaatgcagaagaacagctcctatatgcgatgaactaaaaaacaagggttttgac
aagaaaattagagaaaagacaggacttgtagtagatgcatatttttcaggaactaaagta
aaatggattttggataatgtagaaggggcccgtgaaaaagcagaaaaaggagaattgctt
tttggaaatattgatacctggcttatttggaatttgacaaggggtaatgtacacgtaact
gactattccaatgcttcaaggacgatgctttttaatatacatgagcttaaatgggataaa
gagatattggctgaacttaacataccagagcaaatgcttccggaagttaagccttccagt
tatgtatatggctatactgataaaagtatatttggagtagagatacctattgccggagat
gcgggagaccagcaggcagctttgtttggtcaagcctgtttcaaacctgggatggcaaaa
aacacctatggaacaggctgctttatgctcatgaatactggtgaaaaggctgtaccttcc
aatactggacttctcactacaatcgcttggggaattgatggcaaagtagaatatgcctta
gagggtagtatatttatagcaggtgctgcgatacagtggctgagagacgagcttagaata
attgacaattcacctcaaagtgaggaatatgcgttgaaagttgaagacacaaatggtgta
tatgttgttcctgcttttgtaggattaggagccccttattgggatatgtatgcgagaggc
actattgtaggacttacaagaggcgcaaagagagaacatataataagggcaacacttgag
tctattgcttatcagacaagagatgtattagaggctatgcaagaggattcaggaatcaaa
ttacaagctttaaaagttgacggtggagcaagtgctaataacttcttgatgcaattccaa
tctgacattttaggtgttccagttgacaggcctcaagtaattgaaactactgctcttggc
gcttcttatcttgcgggattggcagtaggattctggaacagcaaagaagaaatagagaag
aattggaatgttgataaacattttgaaccagctatggataatgaaaagagagaaaaattg
tataaaggttggaaaaaggctgtagaaagggctatgaaatgggctgaagaataa

DBGET integrated database retrieval system