KEGG   Thermoanaerobacter wiegelii: Thewi_2144Help
Entry
Thewi_2144        CDS       T01607                                 

Definition
DNA polymerase LigD, ligase domain-containing protein
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:twi03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:twi03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:twi03430]
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:twi03450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2172084..2173007
Genome map
AA seq 307 aa AA seqDB search
MSMIEEKISPMLASSSDPFDSPEWIYEIKWDGSRTIAFLSSKTRLQDRRLVDITYKFPDL
ALLHKQIKAKEAILDGELVVLKNGKPSYKSIMSRKHQQNLLKINLLSKIMPVIFITWDIL
YLNGKPLVELPLIERKDILRKTVKENEIIKISDFIFEHGKMLFEETGKKGLEGIVAKKAD
SKYLIGKRSKLWLKSKHFIVINAVIIGYRTDKTALILGLYDEENNLINIGSCESGLSQKE
LKAFYEVAKEIKAPDNYYNFKEKNVQWLKPLLTCKVRFMEWSENMKMRAPSFIQFEYNVK
PEECRFE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgatagaagaaaaaatatcacctatgctggcatccagcagtgacccttttgat
agccccgagtggatatatgaaatcaaatgggatggttcaaggactattgctttcctttct
agtaaaacaagacttcaagatagaaggcttgttgatataacctataagtttccagatttg
gcattacttcataagcaaataaaagcaaaagaagcaatacttgacggtgaacttgtagtc
ttaaaaaacggcaagcctagttacaaaagcattatgtcaagaaagcatcagcaaaattta
ttaaaaataaatcttttaagcaagataatgcctgtaattttcataacatgggatatattg
tacttaaacggcaaacctcttgtagaattgccacttatagagagaaaagatatacttaga
aaaacagttaaagaaaacgagatcataaaaatatcagattttatatttgaacatggaaaa
atgctttttgaagagacagggaaaaaaggacttgaaggaattgttgccaaaaaagcagat
tcaaaatatttaataggaaaaaggagtaaactctggcttaagtcaaaacattttattgta
ataaatgctgttattatagggtacagaactgacaaaacagccctcatactggggctttac
gatgaggaaaataatttaataaacataggaagttgtgaatcaggcctatcccagaaggaa
ttaaaagcattctatgaagttgccaaggagataaaagccccagataattattataacttt
aaagaaaaaaatgtgcagtggttaaaacccttgctaacatgtaaagtgagatttatggaa
tggtctgaaaacatgaagatgagggcaccttcttttattcaatttgagtataacgtaaaa
ccagaagagtgcaggtttgaataa

DBGET integrated database retrieval system