KEGG   Thermoanaerobacter wiegelii: Thewi_2214Help
Entry
Thewi_2214        CDS       T01607                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:twi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Thewi_2214
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Thewi_2214
Enzymes [BR:twi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Thewi_2214
Two-component system [BR:twi02022]
 CheA family
  CheA-CheYBV
   Thewi_2214
Bacterial motility proteins [BR:twi02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Thewi_2214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2260460..2261557)
Genome map
AA seq 365 aa AA seqDB search
MKKKIRVLVVDDSAFMRKCLKDILENEEDIEVIDTARDGNEAVKKAVELRPDVITLDINM
PVMDGLTALQYIMSLAPCPVVIISSLSTEGALTTFEALELGAVDFVAKPGGTISLGIKQL
ADEIVSKVRIAALSNKELISSPRTFKKSLKRKKYDITGKTYENKIVKNEIVVVIGVSTGG
PKTLMEILPYLPSDFPAAVLVVQHMPPGFTQSFAQRLDQSCNLKVKEAEDRAIVEPGTII
IARGGWHLVLERDSRSSKLITKLTQKPEEALYKPSINVTMKSVLENVDGRNIIGVLLTGM
GDDGADMMVEIRKRGGLTIAESQETAIVYGMPREAVERGGAEIVAPAYKISDILLKKVNE
YAKTP
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaaattcgcgtactcgtagtggatgactctgcttttatgcgaaagtgtcta
aaagatatacttgaaaatgaggaagacattgaagtaattgataccgctcgtgatggtaat
gaggcggtaaaaaaagcagtagaacttcgtcctgatgtgataactcttgatataaatatg
ccagtgatggatgggcttacggcattgcagtacataatgtctcttgcaccatgccctgtt
gtaattatttcatctctttctacagagggagctttaaccacatttgaagctctcgaactc
ggagccgttgattttgtggcaaaaccaggaggcacaatttcgttgggaataaagcagctt
gcagacgaaattgtgtcaaaagtgaggatagctgctttatcgaataaggagttaataagc
tctccaagaacttttaaaaagtctttgaaacgtaaaaagtacgatataactgggaaaaca
tatgaaaataaaattgtcaaaaacgaaattgtggtagtaattggagtttctacaggggga
ccaaaaacgctgatggaaattttaccttatcttccttcagattttccggcggctgtgttg
gtagttcagcatatgccgccaggttttacacaatcttttgctcaacgtctagatcaaagc
tgtaatttaaaagtaaaggaagctgaagacagagcaatcgtggaacctggaacaattatt
attgcaagaggtggctggcacctcgtgctggaaagagattcaagaagttctaagcttatt
actaaattaactcaaaaacccgaagaggcgctttataagccttctattaacgttaccatg
aaatcggtacttgaaaatgtagatgggcggaatattataggtgtgcttttgacgggtatg
ggtgatgacggagcagatatgatggttgaaataagaaaacgaggcgggttaactatagca
gaatcacaagagactgctatagtatatggtatgccaagagaagctgtagagcgtggtgga
gctgagatagtagcccctgcttataagataagtgatattttgctaaagaaggtgaatgag
tatgcaaaaactccataa

DBGET integrated database retrieval system