KEGG   Thermoanaerobacter wiegelii: Thewi_2214Help
Entry
Thewi_2214        CDS       T01607                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:twi02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:twi02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2260460..2261557)
Genome map
AA seq 365 aa AA seqDB search
MKKKIRVLVVDDSAFMRKCLKDILENEEDIEVIDTARDGNEAVKKAVELRPDVITLDINM
PVMDGLTALQYIMSLAPCPVVIISSLSTEGALTTFEALELGAVDFVAKPGGTISLGIKQL
ADEIVSKVRIAALSNKELISSPRTFKKSLKRKKYDITGKTYENKIVKNEIVVVIGVSTGG
PKTLMEILPYLPSDFPAAVLVVQHMPPGFTQSFAQRLDQSCNLKVKEAEDRAIVEPGTII
IARGGWHLVLERDSRSSKLITKLTQKPEEALYKPSINVTMKSVLENVDGRNIIGVLLTGM
GDDGADMMVEIRKRGGLTIAESQETAIVYGMPREAVERGGAEIVAPAYKISDILLKKVNE
YAKTP
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaaattcgcgtactcgtagtggatgactctgcttttatgcgaaagtgtcta
aaagatatacttgaaaatgaggaagacattgaagtaattgataccgctcgtgatggtaat
gaggcggtaaaaaaagcagtagaacttcgtcctgatgtgataactcttgatataaatatg
ccagtgatggatgggcttacggcattgcagtacataatgtctcttgcaccatgccctgtt
gtaattatttcatctctttctacagagggagctttaaccacatttgaagctctcgaactc
ggagccgttgattttgtggcaaaaccaggaggcacaatttcgttgggaataaagcagctt
gcagacgaaattgtgtcaaaagtgaggatagctgctttatcgaataaggagttaataagc
tctccaagaacttttaaaaagtctttgaaacgtaaaaagtacgatataactgggaaaaca
tatgaaaataaaattgtcaaaaacgaaattgtggtagtaattggagtttctacaggggga
ccaaaaacgctgatggaaattttaccttatcttccttcagattttccggcggctgtgttg
gtagttcagcatatgccgccaggttttacacaatcttttgctcaacgtctagatcaaagc
tgtaatttaaaagtaaaggaagctgaagacagagcaatcgtggaacctggaacaattatt
attgcaagaggtggctggcacctcgtgctggaaagagattcaagaagttctaagcttatt
actaaattaactcaaaaacccgaagaggcgctttataagccttctattaacgttaccatg
aaatcggtacttgaaaatgtagatgggcggaatattataggtgtgcttttgacgggtatg
ggtgatgacggagcagatatgatggttgaaataagaaaacgaggcgggttaactatagca
gaatcacaagagactgctatagtatatggtatgccaagagaagctgtagagcgtggtgga
gctgagatagtagcccctgcttataagataagtgatattttgctaaagaaggtgaatgag
tatgcaaaaactccataa

DBGET integrated database retrieval system