KEGG   Thermoanaerobacter wiegelii: Thewi_2310Help
Entry
Thewi_2310        CDS       T01607                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Thewi_2310
Enzymes [BR:twi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Thewi_2310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2353330..2353830)
Genome map
AA seq 166 aa AA seqDB search
MSEVYLSLGSNLGDREENLKRAVFELEHWEGIILKKLSPIYETKPVGYLNQDMFLNIAVE
VETNIGPYDLLKVVNEIEKKLKRERLIRWGPRTIDIDILLYDDIELKDEVLTIPHPRMWE
RAFVLIPLSDINPFIKKGDVYIKDLIAELPDKEGVKLYKENWYNGV
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagtgtatttatctttaggttctaatttaggagatagggaagaaaatttaaaa
agagccgtttttgagttagaacactgggaaggcataattttaaagaagctttctcctatt
tatgaaacaaaacctgtaggatatttaaaccaggatatgtttttaaatattgcagttgaa
gtggagacaaacattgggccttatgacttattaaaagttgtaaatgaaattgaaaaaaaa
ttaaaacgagaaagactcataagatggggtccaaggactattgatattgacatactgttg
tacgatgatattgaattaaaggatgaagtgttgactattcctcatccgagaatgtgggag
agagcttttgtgttgattcctctttcggatataaacccttttataaaaaaaggagatgtg
tatattaaagatttaatagcggagttgcctgataaagaaggagttaagctgtataaagag
aattggtacaatggggtgtaa

DBGET integrated database retrieval system