KEGG   Thermoanaerobacter wiegelii: Thewi_2490Help
Entry
Thewi_2490        CDS       T01607                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thewi_2490
   01230 Biosynthesis of amino acids
    Thewi_2490
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thewi_2490
  Energy metabolism
   00680 Methane metabolism
    Thewi_2490
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thewi_2490
Enzymes [BR:twi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Thewi_2490
Exosome [BR:twi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Thewi_2490
  Exosomal proteins of melanoma cells
   Thewi_2490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2510968..2511723)
Genome map
AA seq 251 aa AA seqDB search
MHKVVLLRHGESLWNMENRFTGWTDVDLSPRGIEEARESGKTLKAEGYTFDCAFTSVLKR
AIRTLWIVLDELDRMWIPVYKSWRLNERHYGALQGLNKAETAKKYGEQQVKIWRRSADVR
PPALTKDDPRYAGFDPRYADLSEEEIPLTENLIDTINRVILYWESTIAPTIKSGKKVIIV
AHGNSLRGLVKYLDNLSNEEIMELNIPTGIPLVYELDDDLKPIRHYYLADEEKVKEKKEL
VAKQGKIQGNS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcataaggttgttttactgcggcatggagaaagcctgtggaatatggaaaatagattt
actggctggacggatgtggatctgtcaccgagaggtattgaagaggcaagagagagtggc
aaaactttaaaggcagaaggatacacttttgattgtgcttttacttctgtacttaaaagg
gctataagaactttgtggattgttcttgatgaattggacaggatgtggataccggtttac
aaatcatggaggcttaatgaaaggcattatggagcacttcaagggctcaataaagctgag
actgccaagaaatacggagaacagcaggtaaaaatatggagaaggtctgctgatgtaagg
cctcctgcattgacaaaagatgacccaaggtatgccggttttgaccctagatatgctgac
ctttctgaagaggaaattccccttactgaaaacttgattgatacaattaacagagttatt
ctctattgggaatctacaattgctccaactataaaatctggtaaaaaggtcattatagtc
gctcatggcaacagtttgagagggcttgtgaaataccttgacaatctttcaaatgaggag
ataatggagctaaacatccctacaggaattcccttagtttatgagcttgatgatgattta
aagcctataaggcattattatcttgccgatgaagagaaagtaaaagagaaaaaagaatta
gtagctaaacaagggaagattcaaggaaattcttaa

DBGET integrated database retrieval system