KEGG   Thermoanaerobacter wiegelii: Thewi_2535Help
Entry
Thewi_2535        CDS       T01607                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Thewi_2535
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thewi_2535
   00620 Pyruvate metabolism
    Thewi_2535
   00650 Butanoate metabolism
    Thewi_2535
  Lipid metabolism
   00071 Fatty acid degradation
    Thewi_2535
  Amino acid metabolism
   00350 Tyrosine metabolism
    Thewi_2535
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Thewi_2535
   00626 Naphthalene degradation
    Thewi_2535
Enzymes [BR:twi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Thewi_2535
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Thewi_2535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2565349..2567967
Genome map
AA seq 872 aa AA seqDB search
MLNLLQERREVKEKTEVKETLDVKRQIDQLVEKAQRAQEKFMSYTQEQIDKIVKAMALAG
IENHVRLAKLAHEETKMGVYEDKITKNLFAVEYVYNYIKDKKTVGVLSENLEENYMEVAE
PVGVIAGVTPVTNPTSTTMFKSLIAIKTRNPIIFSFHPKALKCSIEAAKTMYEAALKAGA
PEGCIGWIETPSIEATQLLMTHPGVSLILATGGAGMVKAAYSSGKPALGVGPGNVPCYIE
KTANIKRAVSDLILSKTFDNGTVCASEQAVIIDEEIADEVKKLMKEYGCYFLNKEDTKML
EEFAIDKNTGLMNPAVVGQPATKIAEMAGFKVPENTKILVAEYPAVGPEYPLSREKLSPI
LALYTVKDYNEGIKRCEEMTEFGGLGHSAVIHSENQQIINEFAKRVRAGRILINAPASQG
AIGDIYNTAIPSLTLGCGTMGRNSTTDNVSVYNLINIKRVFIRKERMKWFRVPPQIYFER
GSLQYLSQVKGKKAFIVTDPVMVKLGFVDKVTYQLDKANIKYEIFSEVEPDPSVDTVEKG
VKIMRGFEPDLLIAVGGGSAIDAAKGMWLFYEYPDTKFEDLRLKFMDIRKRTYRFPELGK
KALFIAIPTTSGTGSEVTAFAVITDKKKNIKYPLTDYELTPDIAIIDPDLTMTIPPSVTA
DTGMDALTHAIEAYVSVMASDYTDALAEKAIKLIFEYLPKAYKNGQDKVAREKMHNASCI
AGMAFTNAFLGKNHSMAHILGAKFHLPHGRANAILLPYVIEYNAELPKKFASFPQYEYPK
AAEKYAEIAKFLGLPASTVEEGVKSLIEAIKNLMKELNLPLTLKEAGINKEEFEKQILEM
SDIAFNDQCTGSNPRMPLVSEIAEIYRKAYGE
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgcttaacttattacaagaaagaagagaagtaaaagaaaaaacagaagtgaaagaaacg
ctggatgttaaaagacaaatagaccaattagtagaaaaagcacaaagagcacaagaaaaa
ttcatgtcttatacccaagaacaaatagataaaatagttaaagctatggctttggctggt
attgaaaatcatgtgagattggcaaaattagcccatgaagaaacaaaaatgggtgtttat
gaagacaaaataacgaaaaatctttttgcagtagaatatgtgtacaattatataaaagac
aaaaagactgtcggcgtccttagtgaaaacttagaagaaaattatatggaagtggcagaa
cctgtaggagttatagccggcgtaacacccgttacaaaccctacttctacaacaatgttc
aaaagcttaatcgctattaaaacaagaaatccaataatttttagctttcacccaaaagca
ttaaaatgtagtatagaagcagcaaagaccatgtacgaggcagcattaaaagctggtgca
ccagaaggatgcataggttggattgaaacgccttcaattgaagcaacgcaacttctcatg
acacatcccggcgtctcccttatcctcgcaacaggcggcgctggaatggtaaaagccgct
tacagctcaggaaaacccgcccttggcgtaggtcctggcaatgtcccctgctacattgaa
aaaactgcaaatattaaaagagcagtctcagacctaatacttagcaaaacttttgacaat
ggcacagtatgcgcatcagaacaagctgtgataatagacgaagaaatagcagatgaagtg
aaaaaattaatgaaagaatatggttgctattttctcaataaagaagatactaaaatgcta
gaagaattcgctatagacaaaaacaccggtttaatgaatccagcagttgtaggtcaaccg
gcaacaaaaattgctgaaatggctggatttaaagtacctgaaaacacaaaaatacttgta
gctgaatatcctgctgtaggaccagaatatcctctctccagagaaaagctaagtccaata
cttgctttatacacagtcaaagattacaacgaaggcataaaaagatgtgaagaaatgaca
gaattcggcggacttggtcactctgcagtaatacattctgaaaaccaacaaattattaat
gaatttgcaaaaagagtacgagcaggaagaattcttataaacgcccctgcttctcaagga
gctattggagatatttataacacggctatcccatctttgactttgggttgcggtacaatg
ggtagaaattcaacaacagataatgtaagtgtttataaccttataaacataaaacgagtt
tttataagaaaagagagaatgaaatggttcagagttccaccacaaatttattttgaaaga
gggtcattacaatatctgtcacaagtaaaaggcaaaaaagcctttattgtaacagaccct
gtgatggttaaattaggttttgtagataaagtaacgtatcaattagataaggcaaatatt
aaatatgaaatattctctgaagttgaaccagatccttcagttgacactgtagaaaaaggg
gtaaaaataatgagagggtttgagcctgacttactaatagctgtaggtggtggttctgca
atagatgcagcgaagggaatgtggcttttctacgaataccctgatacaaaattcgaagac
ttaaggttaaaatttatggacataagaaaaagaacttatagatttcctgaactggggaaa
aaagctttatttatcgcaataccaaccaccagcggtacaggttctgaagttactgccttt
gcagttataacagacaaaaagaaaaatataaagtaccctctcacagattacgaattaaca
ccagatatcgctataatagaccctgacctcacaatgacaataccaccctctgtcacagca
gacactggtatggacgctttaacccatgctattgaagcctatgtatctgtaatggcatca
gactatacagacgctctcgcagaaaaagctataaaattgatatttgaatatctacctaaa
gcatacaaaaacgggcaagataaagtcgcccgcgaaaagatgcacaatgcttcatgcata
gctggaatggccttcacaaatgcatttttaggaaaaaaccatagtatggctcatatactt
ggtgctaaattccatcttccacacggaagagcaaatgcaatacttctgccctatgtcata
gaatacaatgctgagttacctaaaaaatttgcttcattcccacaatatgaatatcccaaa
gcagccgagaaatatgcagaaattgcaaaattcttgggacttcctgcttcaacagttgaa
gaaggagtaaaaagcctcattgaagcgataaaaaatctcatgaaagagcttaatcttcct
ttgacacttaaagaagcaggcataaataaagaagaatttgaaaaacaaatattggaaatg
tcggatatagcctttaacgaccagtgcactggctcaaatccaagaatgccattggtatcc
gaaattgcagaaatatatagaaaagcttatggtgaataa

DBGET integrated database retrieval system