KEGG   Tropheryma whipplei TW08/27: TW035Help
Entry
TW035             CDS       T00117                                 

Definition
epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
tws  Tropheryma whipplei TW08/27
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tws00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    TW035
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TW035
Enzymes [BR:tws01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     TW035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
31892..32515
Genome map
AA seq 207 aa AA seqDB search
MELRNLKVNGCLEVTPEVHVDSRGSFSEVYRFDVLEKEIGYPLRVAQVNRSFSKKAVLRG
LHYSLAPHSQAKYVMCANGAVLDFVFDLRLGSPSFGVWDAVLLDSVGCRAVYIPEGVGHA
FIALSKTATVNYLCSATYDPEREKSINPLDKNLNLEYPFTTPEIVLSERDAAAPTLPEAQ
KGGFLPKWDECRWDECRATPETHGNIR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggaattacgtaatcttaaagttaacggctgcctcgaggttaccccagaggttcatgtg
gactccaggggttcattctctgaggtgtaccgttttgatgttttggagaaagagattggg
tatccgctccgggttgctcaggtaaatcgttctttttccaagaaggctgttctgcgaggg
ctgcattactctcttgcgccgcactctcaggcaaagtacgttatgtgtgcgaatggcgca
gtgttagattttgtgtttgaccttcgcttggggtcaccgagtttcggggtgtgggacgcg
gtcctgctcgactctgtaggttgtagggctgtttacatcccagaaggggttggtcacgcg
tttattgcgttatccaagactgccactgtgaactacttgtgcagcgcaacctacgatccg
gagcgagagaagagtattaatccgctcgataaaaatctcaatctagaataccctttcact
actcctgaaatagtgttatccgagagggatgctgctgccccgactttacctgaagcgcaa
aagggtggtttcctgccaaaatgggatgaatgccggtgggatgaatgccgggcaacaccc
gagacacacggaaacattcgataa

DBGET integrated database retrieval system