KEGG   Tropheryma whipplei TW08/27: TW174Help
Entry
TW174             CDS       T00117                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tws  Tropheryma whipplei TW08/27
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tws00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
216002..216547
Genome map
AA seq 181 aa AA seqDB search
MTKLCRFESGSAQSAVANLLSALGQDVGRLKETPSIASSGLESLISGSETNPADCLVDLI
PNTQKGIVILRDIPFRSICEHHLLPFVGTANLLYEPGKFLAGLGNLTSLVRCAARRLSIQ
ERVTDQIADAIYTGLCARRVLVSLAARHTCILDEAGNTEVTTFAHRGIGDADIISFMTII
R
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaagttgtgtagatttgagagtggttcggcgcaatccgcggtggcgaatttgctg
tccgcgcttgggcaggacgtaggcaggctaaaggagactccttctattgcatcctctggc
cttgagtctcttatctctggtagtgaaacgaatccagcagattgccttgttgacctaatt
cccaacacacaaaaggggattgtgattttgcgcgatataccattcagatcgatctgtgaa
catcacttattaccatttgtgggcacggcgaatctgctgtatgaaccagggaagtttctt
gcaggcctaggtaatctcacttccctggtgcgatgtgctgcgcggcgccttagcattcag
gagcgcgtaacagatcaaatagctgatgcgatttatacgggcctttgtgcgcgccgcgtt
cttgtgtcacttgctgcccggcatacctgcattttggatgaagctggaaatacagaagtt
acgaccttcgcgcatcggggtataggagatgccgatatcatctcttttatgacaataatc
cggtag

DBGET integrated database retrieval system