KEGG   Tropheryma whipplei TW08/27: TW330Help
Entry
TW330             CDS       T00117                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tws  Tropheryma whipplei TW08/27
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tws00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TW330 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TW330 (thrC)
Enzymes [BR:tws01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TW330 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
361919..362971
Genome map
AA seq 350 aa AA seqDB search
MYFRGIINEYRSRLGLDADLKVVTLGEGNTPLVYSEALSSLTASSVWLKFDGANPTGSFK
DRGMTVAVSKAVNSGVRTVICASTGNTSASAAAYSAAAGIECVVLIPEGFVSHGKLCQAV
AHGARVLQIRGNFDSCLRVARELAEIHPVHLVNSINPDRISGQKTAAFEIIDALGDAPDY
HYLPVGNAGNYTAYYLGYSEEKVRGNSTHIPRIFGFQASGAAPIVSGHIVENPQSIATAI
RIGNPASWKQALHAQHACNGYFGSIDDSGILEAQKLLARTCGLFVEPASAISVAGLLASK
PPEGSSVVCTLTGHGLKDQQLAFRKSDGTEYSLPSLPGDSQSIASYLNLA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtattttagagggattatcaacgagtacagatcacgcctggggcttgacgcggacctt
aaggttgttacccttggtgagggtaataccccccttgtgtattcagaagctctgtcgagc
ctaactgcctcttctgtgtggttaaagtttgatggcgctaacccaactgggtcgttcaaa
gatagaggtatgacagttgccgtatcaaaagctgtgaattcgggcgtgcgcacggttatt
tgcgcatcaacaggtaacacttctgcttcagccgcagcttattccgccgctgcaggtata
gagtgcgttgttctcatccccgagggcttcgtaagtcatggtaagttgtgccaggctgtc
gcacacggcgcgagagttttgcagattagaggaaattttgattcatgcctcagagtggct
agggagctcgcagaaattcaccccgtacaccttgtaaactcaataaatccagaccgtata
agcggacaaaaaactgctgcgtttgagataattgatgccctgggggatgcgccagattac
cattatcttcctgttggtaatgctggtaattacacggcatactatcttggatacagtgaa
gagaaagttcgtggaaacagtacccatattccgcgtattttcggctttcaggcaagtggt
gctgctccgattgtctcagggcatattgttgaaaatccgcagtcaatagcaactgctatt
cgtattggcaatccggcttcttggaaacaggctctgcatgcccaacacgcgtgtaatggt
tattttgggagtatagatgattcaggcatcctcgaggcacagaaattattggcacgcact
tgtgggttatttgttgaaccggccagtgcgataagcgttgcaggccttcttgcctcaaaa
cccccagagggcagtagtgttgtgtgcactctaactggccatggattgaaggatcaacag
ctggcctttcgtaaatctgatggcacagagtattcccttccgtcattacccggtgattcg
caatcaatagcttcatatttgaatctcgcgtga

DBGET integrated database retrieval system