KEGG   Tropheryma whipplei TW08/27: TW406Help
Entry
TW406             CDS       T00117                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tws  Tropheryma whipplei TW08/27
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tws00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
444443..445024
Genome map
AA seq 193 aa AA seqDB search
MQLFDLWTDLLDLLTIVAGPTAVGKGTVISHLRKCHPQVKVSISATTREPRDSERDGIDY
YFVTDEVFDCMVRSGQMLEWATVHGLHKYGTPKEEVERLLHTGQPVILEIDLQGMRKVRK
ILPAVRTVILLPPAWDDLICRIKRRGSESQDEIDARLATAKKELEAIGEFDYKIVNADVE
IAANELWLAMNRV
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgcagctttttgacttatggactgaccttttggatcttttgaccattgttgccgggcca
acggcagttggtaagggtacggttataagccatttaagaaaatgtcaccctcaagtcaaa
gtttctatatctgctacaacaagagagccgagggatagcgaaagagatggtattgattat
tattttgttaccgatgaggtatttgattgcatggtaagaagtgggcaaatgcttgaatgg
gccaccgtgcatggccttcacaaatacggaacgccaaaggaagaagttgaacgtctgctg
cacacgggccagccggtcatactcgaaattgatctccaaggaatgcgcaaggtaaggaag
atattgcctgcagttagaacggttattttactgcctcccgcttgggatgacttgatttgt
agaataaaacgccgcgggagtgaatcacaggatgaaattgatgcacgtctggcaacagca
aaaaaggaacttgaggctataggcgagtttgactacaagattgtcaatgctgatgttgaa
attgcggcaaatgaattatggctggccatgaatcgtgtttaa

DBGET integrated database retrieval system