KEGG   Tropheryma whipplei TW08/27: TW445Help
Entry
TW445             CDS       T00117                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K18369  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
tws  Tropheryma whipplei TW08/27
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:tws00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TW445 (adh)
Enzymes [BR:tws01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     TW445 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(485059..486129)
Genome map
AA seq 356 aa AA seqDB search
MRMKALVYHGPGKRSLDTVDDPTIKLGTDVILEMETTTICGSDLHILKGDVAAVKPGTVL
GHEGIGKIVEVGKDVKSHSVGDRVIVSPMSSCGVCRFCRANNNGHCLGDSEGPGGWRLGG
LINGVQAQFARIPLADNSLHKLPSGLDPKVGILVSDVLPTGHEVGAQAGQVTLGSVVAVI
GCGPVGLGAIVTSLLYSPSKVIAVDADSNRLELARKLGATDTVRVNRERPLDAIEDVKKL
TEGGFGVDVAIEAVGVPVTFSMALGIAAPGGRVANIGVHGAPVDFPLQDLWDKNIAVTLG
IVSTHTIPLLLAALSEGKIDASQFVTHEFDLSDLERAYDVFSAAAQHNVVKVAIRA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcatgaaagcgcttgtttatcacggacctggaaaaaggagtctggacacagttgat
gacccgactataaagcttggcacggatgtcatccttgaaatggagactactacgatatgc
ggtagtgatcttcatattctcaaaggtgatgttgcggccgtgaaaccgggtactgtgctc
ggacatgaagggattgggaagatagttgaggtcggtaaagacgttaaatcccattcggtt
ggcgatcgtgttatcgtctctccaatgtcttcctgcggagtttgtaggttctgtagggcg
aataataacggtcattgtctgggtgattcagagggtcccgggggatggcgtcttggtggt
ctgattaacggggttcaagctcagtttgccaggataccgcttgcagataattcacttcac
aaacttccctctggcctcgatccaaaggttggcatattggtgtctgatgttcttccgact
ggccatgaagtgggtgcacaggctgggcaggttactctcggtagtgtagttgccgtaatt
ggctgcggccctgttggattgggcgcaattgttacgagcttgctttactcaccttcaaag
gtaattgcagttgatgctgactctaaccgtcttgagttagcccgaaagttgggtgcgaca
gataccgtgcgtgtcaatagggaaaggcctcttgatgcaattgaagatgttaagaagctc
acagaaggtggcttcggggtcgatgttgcgatagaggcggttggtgttccggtaactttc
agtatggcgcttgggattgctgcgcccggtgggagagttgccaatattggtgttcatggg
gcaccggttgactttcccctccaagacctgtgggacaaaaacattgccgtaacactgggc
attgttagtacacatacgattcccctccttcttgctgcgctttctgagggcaaaatcgat
gcaagtcaattcgttacacatgagtttgatctgtccgatttggagagggcgtatgatgtt
ttctctgctgcggctcaacacaacgtcgtcaaggtagctattagagcttaa

DBGET integrated database retrieval system