KEGG   Tropheryma whipplei TW08/27: TW470Help
Entry
TW470             CDS       T00117                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tws  Tropheryma whipplei TW08/27
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tws00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TW470 (tpiA)
   01230 Biosynthesis of amino acids
    TW470 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TW470 (tpiA)
   00051 Fructose and mannose metabolism
    TW470 (tpiA)
   00562 Inositol phosphate metabolism
    TW470 (tpiA)
Enzymes [BR:tws01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TW470 (tpiA)
Exosome [BR:tws04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TW470 (tpiA)
  Exosomal proteins of bladder cancer cells
   TW470 (tpiA)
  Exosomal proteins of melanoma cells
   TW470 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(503561..504442)
Genome map
AA seq 293 aa AA seqDB search
MLPKRAYPVQDSNVHSQEKKIIAGNWKMNINHSQAVSYLQELNWRLIDNGHDFDACEIAV
FPPFTDLRSVQTLVASDDIQISYGAQDVSAFSDGAHTGQISAQFLKDLDCKYVLIGHSEQ
RCLPCYPGNNSAINELNNKHDGLIANKLLRSFAAGICPILCIGDISPGDHFDATLSRFRS
VLSHLKAISDKKHSIGYALGSKTHFLDSDQLHMLVAYEPSSAINSGNCANSGDIVRMAAA
IKDIVNVRVLYGGGVNLFNASAVFNEDLLDGILVGRASLNASDFASLIKTCCL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcttccaaagcgcgcgtatcccgtgcaagactcgaatgttcactctcaagagaaaaaa
ataattgccggcaattggaagatgaacataaatcatagtcaggctgtttcgtatttacag
gagctcaactggaggcttattgataatggtcatgattttgatgcctgtgagattgcagta
ttcccgccgttcactgatcttcgttccgtacaaactctcgttgcatcggatgacatacag
atatcatacggagcccaggatgtctccgcattttcagatggcgcacatacaggtcagatt
tcagcccagtttttgaaagatctagactgcaagtacgtcctaataggtcattcagagcaa
agatgtttaccatgctaccccggcaacaatagtgcaatcaatgagctcaataacaagcac
gacggtcttattgcaaataaattattgagaagctttgcggcggggatttgtccgatcttg
tgtattggtgatatttcaccgggtgatcattttgatgcaactctgtctagatttcgttct
gttctaagtcacctcaaagcgatatcagataaaaaacatagcatcggttacgcccttgga
tccaaaacacactttttagatagcgatcagttacacatgttggttgcttatgaaccctca
tcggctattaactcgggaaactgtgcaaattcaggagacattgtcaggatggctgcagca
ataaaagacattgtaaatgttcgggtgctctacggtgggggagtgaatctatttaacgca
tctgcagtttttaacgaggatttgctggacggcattcttgttggcagagcttccttgaat
gcatctgatttcgcatccctgataaagacgtgctgtttgtaa

DBGET integrated database retrieval system