KEGG   Tropheryma whipplei TW08/27: TW470Help
Entry
TW470             CDS       T00117                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tws  Tropheryma whipplei TW08/27
Pathway
tws00010  Glycolysis / Gluconeogenesis
tws00051  Fructose and mannose metabolism
tws01100  Metabolic pathways
tws01110  Biosynthesis of secondary metabolites
tws01120  Microbial metabolism in diverse environments
tws01130  Biosynthesis of antibiotics
tws01200  Carbon metabolism
tws01230  Biosynthesis of amino acids
Module
tws_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tws00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TW470 (tpiA)
   00051 Fructose and mannose metabolism
    TW470 (tpiA)
   00562 Inositol phosphate metabolism
    TW470 (tpiA)
Enzymes [BR:tws01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TW470 (tpiA)
Exosome [BR:tws04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TW470 (tpiA)
  Exosomal proteins of bladder cancer cells
   TW470 (tpiA)
  Exosomal proteins of melanoma cells
   TW470 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAD67137
UniProt: Q83HP9
Position
complement(503561..504442)
Genome map
AA seq 293 aa AA seqDB search
MLPKRAYPVQDSNVHSQEKKIIAGNWKMNINHSQAVSYLQELNWRLIDNGHDFDACEIAV
FPPFTDLRSVQTLVASDDIQISYGAQDVSAFSDGAHTGQISAQFLKDLDCKYVLIGHSEQ
RCLPCYPGNNSAINELNNKHDGLIANKLLRSFAAGICPILCIGDISPGDHFDATLSRFRS
VLSHLKAISDKKHSIGYALGSKTHFLDSDQLHMLVAYEPSSAINSGNCANSGDIVRMAAA
IKDIVNVRVLYGGGVNLFNASAVFNEDLLDGILVGRASLNASDFASLIKTCCL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcttccaaagcgcgcgtatcccgtgcaagactcgaatgttcactctcaagagaaaaaa
ataattgccggcaattggaagatgaacataaatcatagtcaggctgtttcgtatttacag
gagctcaactggaggcttattgataatggtcatgattttgatgcctgtgagattgcagta
ttcccgccgttcactgatcttcgttccgtacaaactctcgttgcatcggatgacatacag
atatcatacggagcccaggatgtctccgcattttcagatggcgcacatacaggtcagatt
tcagcccagtttttgaaagatctagactgcaagtacgtcctaataggtcattcagagcaa
agatgtttaccatgctaccccggcaacaatagtgcaatcaatgagctcaataacaagcac
gacggtcttattgcaaataaattattgagaagctttgcggcggggatttgtccgatcttg
tgtattggtgatatttcaccgggtgatcattttgatgcaactctgtctagatttcgttct
gttctaagtcacctcaaagcgatatcagataaaaaacatagcatcggttacgcccttgga
tccaaaacacactttttagatagcgatcagttacacatgttggttgcttatgaaccctca
tcggctattaactcgggaaactgtgcaaattcaggagacattgtcaggatggctgcagca
ataaaagacattgtaaatgttcgggtgctctacggtgggggagtgaatctatttaacgca
tctgcagtttttaacgaggatttgctggacggcattcttgttggcagagcttccttgaat
gcatctgatttcgcatccctgataaagacgtgctgtttgtaa

DBGET integrated database retrieval system