KEGG   Tropheryma whipplei TW08/27: TW502Help
Entry
TW502             CDS       T00117                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tws  Tropheryma whipplei TW08/27
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tws00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TW502 (ruvA)
Enzymes [BR:tws01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TW502 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(541501..542025)
Genome map
AA seq 174 aa AA seqDB search
MHGIGFLVRVPQSFNPEVDAEVKLYTSLQVREDSVSLYGFASVLECTVFEQLITISGVGP
RVALAILSVLTPAEVAAAVLEGDDKPLQRVSGVGKKLAGTIVLQLAGKLTSVPLENRKQE
QAVDRSAEIVQALIGLGWQRQESAAAVESVLEKDQSLTMPEILRNALRYLAKQE
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgcatggtataggctttttggttcgtgtgccacaatcttttaaccctgaagtagatgct
gaggtaaaactttataccagtcttcaagtccgagaagactcggtttcgctttacggtttt
gcatctgttctggaatgcactgtttttgaacagctaataacaatatccggtgttggcccg
cgggttgcgcttgccatcctttcggttttgaccccggcagaggttgctgcggccgttctg
gaaggtgatgacaagcccttgcagcgagtgagtggtgttggaaaaaagcttgccggaaca
atagtgttacagcttgctgggaaattgacttcggtcccattagagaacaggaaacaggaa
caagcggttgatagaagtgccgagattgtccaggctcttattgggttgggctggcagcga
caggaatctgctgcggccgtggaatctgttttagaaaaagatcagtctttgactatgcca
gaaattttgagaaatgcccttagatatcttgcaaaacaggaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system