KEGG   Tropheryma whipplei TW08/27: TW558Help
Entry
TW558             CDS       T00117                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tws  Tropheryma whipplei TW08/27
Pathway
Glycolysis / Gluconeogenesis
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tws00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TW558 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TW558 (glk)
   00052 Galactose metabolism
    TW558 (glk)
   00500 Starch and sucrose metabolism
    TW558 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    TW558 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TW558 (glk)
   00524 Butirosin and neomycin biosynthesis
    TW558 (glk)
Enzymes [BR:tws01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TW558 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(594860..595777)
Genome map
AA seq 305 aa AA seqDB search
MVRAIGVDIGGTKISAALVDRSGNMDGQLTVPTDPVGVIDQVVELVNKLSDGESVCAVGV
AVASFLNYSRDFVYNSPNLGLENIPIRNLLQNRIKFPVFIENDANAAAWAEWRFAPRSVE
IVNSQDLFMITVGTGVGGAAILDGKILKGGFGIASEPGHIVLVPDGIPCGCGKRGCSEQY
ASGTALLRYVKSNMPDFPFGRNPSDVIGELVAKSDPVVLSAVSQVADNVGRTAAAVTAIL
DPELFVIGGGVSKIGTFFIDSIRESYKEYLPHSESRPCANFRLAHFYNTAGIIGAADLAR
SSLAT
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
ttggtgcgtgcaatcggcgttgatatcggagggacaaagatatcggcggcattggttgat
agatctggcaatatggacggccagcttactgtgccgacagatcccgttggtgttattgat
caggtcgtggagcttgtcaataaactgtctgatggtgaatcggtgtgtgcagttggtgtt
gctgttgccagtttcctaaattatagtcgtgattttgtttataattctcctaatttgggc
ctggaaaatattccgatacgcaaccttttgcaaaacagaattaaatttcccgtttttata
gagaatgatgcaaatgccgccgcgtgggctgagtggcgttttgctccgcgatctgtggag
attgttaattcacaagatttgtttatgattactgttggtaccggtgtgggtggagcggca
attttagacggcaagatccttaaggggggttttggtatcgcttcggagccggggcatatt
gttcttgtgccagacggaattccgtgtggttgtggcaaacgtggctgcagtgaacagtat
gcttctgggactgcgcttttgcgttatgtaaagagcaatatgccagattttccgtttggt
aggaacccgtctgatgtaattggcgagcttgttgccaagtcggatccagttgttctttct
gccgtttctcaagtcgcagataacgtgggtcgcacagcagctgctgttaccgctattttg
gaccctgagttgtttgttatcggtggtggggtcagtaaaattggcacctttttcattgat
tcaataagagagtcttataaagaatatttaccccattcagagtcacggccgtgtgctaat
tttcgattggcccatttttacaatactgctgggattataggcgcagcagacttggcaagg
tcttctcttgctacttga

DBGET integrated database retrieval system