KEGG   Tropheryma whipplei TW08/27: TW558Help
Entry
TW558             CDS       T00117                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tws  Tropheryma whipplei TW08/27
Pathway
tws00010  Glycolysis / Gluconeogenesis
tws00500  Starch and sucrose metabolism
tws00520  Amino sugar and nucleotide sugar metabolism
tws00521  Streptomycin biosynthesis
tws01100  Metabolic pathways
tws01110  Biosynthesis of secondary metabolites
tws01120  Microbial metabolism in diverse environments
tws01130  Biosynthesis of antibiotics
tws01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tws00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TW558 (glk)
   00052 Galactose metabolism
    TW558 (glk)
   00500 Starch and sucrose metabolism
    TW558 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    TW558 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TW558 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TW558 (glk)
Enzymes [BR:tws01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TW558 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: CAD67224
Position
complement(594860..595777)
Genome map
AA seq 305 aa AA seqDB search
MVRAIGVDIGGTKISAALVDRSGNMDGQLTVPTDPVGVIDQVVELVNKLSDGESVCAVGV
AVASFLNYSRDFVYNSPNLGLENIPIRNLLQNRIKFPVFIENDANAAAWAEWRFAPRSVE
IVNSQDLFMITVGTGVGGAAILDGKILKGGFGIASEPGHIVLVPDGIPCGCGKRGCSEQY
ASGTALLRYVKSNMPDFPFGRNPSDVIGELVAKSDPVVLSAVSQVADNVGRTAAAVTAIL
DPELFVIGGGVSKIGTFFIDSIRESYKEYLPHSESRPCANFRLAHFYNTAGIIGAADLAR
SSLAT
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
ttggtgcgtgcaatcggcgttgatatcggagggacaaagatatcggcggcattggttgat
agatctggcaatatggacggccagcttactgtgccgacagatcccgttggtgttattgat
caggtcgtggagcttgtcaataaactgtctgatggtgaatcggtgtgtgcagttggtgtt
gctgttgccagtttcctaaattatagtcgtgattttgtttataattctcctaatttgggc
ctggaaaatattccgatacgcaaccttttgcaaaacagaattaaatttcccgtttttata
gagaatgatgcaaatgccgccgcgtgggctgagtggcgttttgctccgcgatctgtggag
attgttaattcacaagatttgtttatgattactgttggtaccggtgtgggtggagcggca
attttagacggcaagatccttaaggggggttttggtatcgcttcggagccggggcatatt
gttcttgtgccagacggaattccgtgtggttgtggcaaacgtggctgcagtgaacagtat
gcttctgggactgcgcttttgcgttatgtaaagagcaatatgccagattttccgtttggt
aggaacccgtctgatgtaattggcgagcttgttgccaagtcggatccagttgttctttct
gccgtttctcaagtcgcagataacgtgggtcgcacagcagctgctgttaccgctattttg
gaccctgagttgtttgttatcggtggtggggtcagtaaaattggcacctttttcattgat
tcaataagagagtcttataaagaatatttaccccattcagagtcacggccgtgtgctaat
tttcgattggcccatttttacaatactgctgggattataggcgcagcagacttggcaagg
tcttctcttgctacttga

DBGET integrated database retrieval system