KEGG   Tropheryma whipplei TW08/27: TW576Help
Entry
TW576             CDS       T00117                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tws  Tropheryma whipplei TW08/27
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tws00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tws00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(634418..635638)
Genome map
AA seq 406 aa AA seqDB search
MTAHNTPKVHCVIRQALRGQRIGPRQLAEQIGVDIKQLWSWLEPTWSQTLDIPQSILHDL
EDAIDDTSAFYNTQHLLSIDQINRRSLERLFYVTDMFQPLARRQVRCNILNGAVLACLFY
EASTRTRFSFSTAFSRMGGAVVTEADMLQSSSVAKGESTSDTSRVISGYADIVVVRHSEL
GFAERYASDSLVPVINAGDGSGEHPTQAILDVYTIESEFLYREKTIDGSCIAIIGDLKHG
RTVHSLIKLLSLYERLTFKIFSITDLELPNDFHDLLSGRGHTLEVCDSLRNAVNAADVIY
ATRVQTERIAQDLTAVTGCRLTREVLDDCKKDVIVLHPLPRDSRPDALDIGTDLDSYSGF
MPFGQANNGVPVRMAIFSEILGITDKIEFADSIPWARRIPYPQALP
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgactgctcataataccccgaaggttcattgtgttatccgccaggctttacgaggtcag
cgcataggcccccggcagcttgccgagcaaattggtgttgacatcaaacaactttggtca
tggctggaacccacatggtcgcaaacacttgacatcccgcagtccattctgcatgacctg
gaagatgctattgatgacacatccgcgttttacaatactcaacacttgttatccattgac
caaataaatcgcagaagccttgagagattattttatgtaacagatatgtttcagcccctt
gcaaggcgtcaggtgaggtgcaacattctgaacggcgcggtccttgcctgtcttttttac
gaagctagtacgcgtacaagatttagtttttcgactgctttttcccggatgggtggggcc
gttgtgacagaggccgatatgcttcagtcttcctcggttgcaaaaggggaatcaacctca
gacaccagtcgagttatttctgggtatgcggatattgtagttgttcggcattcagaactt
ggatttgctgaaagatacgcctctgacagcttggttccggttataaatgccggagatggt
tcgggcgagcacccgacccaggcgattctggatgtatacacaatagaaagtgaatttctt
tacagagagaaaacaatcgatggaagctgtattgcaatcataggtgatctaaaacacggc
agaaccgttcattcactgattaagcttttatctctttatgagagattaacattcaaaata
ttttctataacagatcttgagcttccgaatgattttcatgatctcctgtctggtcgtggt
cataccctagaggtttgtgacagcttgaggaatgctgtcaatgccgcagatgttatttat
gcaacgcgtgttcaaacagaaaggattgcgcaggacttgacagctgtaacggggtgtagg
ctgacacgggaagtgcttgatgattgtaaaaaggatgtgattgtattgcatccacttcca
cgtgattcccgcccagatgctctagacataggaactgatcttgattcgtacagtgggttt
atgccatttggtcaagcgaataatggggttcctgttagaatggcaatcttctcagaaatc
ctggggataaccgacaaaatagagttcgcagattctataccatgggcaagaagaatacct
tacccccaggccttaccctaa

DBGET integrated database retrieval system