KEGG   Tropheryma whipplei TW08/27: TW711Help
Entry
TW711             CDS       T00117                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
tws  Tropheryma whipplei TW08/27
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:tws00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(803796..804407)
Genome map
AA seq 203 aa AA seqDB search
MPSRHATAVNNRPTSALLVVDIQKDFCEDGALAVLGGNALAKRISCFLSERQLDYALKIA
SRDWHAPNSSNNGHFSENPDFSNSWPIHCVANTPGSAYHDDLPVDLFDKHIYKGFGSAAY
SAFEGFDKKGVPLEEILAGIQQIDIAGIATDYCVYKTAVDSIKNGFITRVLLDLCVEINK
ERSEACIVQLQDLGVHIVNSYHT
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgccctcccgacatgccacggcagttaataaccggccaacctcagctcttctggttgtt
gatatacaaaaggatttctgtgaggatggagcattagcggtccttggaggtaatgcactt
gccaagcggatatcgtgctttttatctgagaggcaattagactatgctttaaaaattgcc
tcaagggactggcatgcaccaaactcgagtaataacgggcatttttcagaaaaccctgat
ttctctaatagctggccgattcactgcgttgccaatactccgggatctgcctatcatgat
gacctgcctgtcgacttgtttgataagcatatttacaagggctttggtagtgctgcatac
tctgcttttgagggttttgataaaaagggagtgccattagaagagattctggcgggtatt
cagcaaattgatatagcgggcatcgcaacggattactgtgtatataaaactgcagttgac
tccataaaaaacggatttataacccgtgttctgcttgatttatgtgttgaaataaacaaa
gaacgaagcgaggcatgtatagtgcagttacaagatctcggggtgcacattgtcaatagt
tatcacacatga

DBGET integrated database retrieval system