KEGG   Tropheryma whipplei TW08/27: TW726Help
Entry
TW726             CDS       T00117                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tws  Tropheryma whipplei TW08/27
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tws00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TW726 (recR)
DNA repair and recombination proteins [BR:tws03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TW726 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(821589..822185)
Genome map
AA seq 198 aa AA seqDB search
MYVRIVQDLIRELGKLPGIGPKSAQRIAFFILQNPSFDIDRLSETLQSVRKQVQFCKVCG
NFSEEDECVICSDPRRDRGVICVVEEPKDVVAIEKTREFSGLYHVLGGAISPIDGVGPDD
LNIRQLLQRLADGTITEVVLATDPNMEGEATASYIARVISAMRIRVSKLASGLPVGSDLE
YADEITLGRALEGRQYIN
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtatgttcgcatagttcaggatctaatacgtgagcttggcaagctacccggcataggt
ccgaagtctgcacagcgcattgccttcttcattttgcagaacccgagttttgatatcgac
aggctatctgagactctccagtctgttagaaaacaggtgcagttctgtaaggtttgtggc
aatttctcggaagaagatgagtgtgtaatttgctcggatccgaggcgtgataggggggta
atttgcgttgttgaagagccaaaggatgttgttgcaatagagaaaacgcgcgaattttct
gggctgtaccatgttctggggggtgcaatcagcccaatagatggggtaggccccgatgac
cttaacataagacagcttttacagcggctggctgatggaacaataacagaggttgttctg
gcgacagacccaaatatggaaggcgaggcgacggcaagctatatagcaagggtcatttca
gctatgcgaataagagtttctaaacttgcctcaggcctcccggttggaagtgatcttgaa
tacgcggacgaaattaccctcggtagggcgctcgagggtaggcaatatataaattaa

DBGET integrated database retrieval system