KEGG   Tropheryma whipplei TW08/27: TW745Help
Entry
TW745             CDS       T00117                                 

Definition
porphyrin biosynthesis protein (EC:2.1.1.107)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tws  Tropheryma whipplei TW08/27
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tws00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TW745
Enzymes [BR:tws01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     TW745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(841752..842477)
Genome map
AA seq 241 aa AA seqDB search
MRHSCHHVWITRGGQWAREIAGMLKVRGVTSVVHPVIDCVPVMGYENELQKIPFFDWLIV
TSSTTAGLLNTPIPQSVKVAAVGRETAESLIRAGHRVSLCPENDFSSDGLASAIQAHLNF
PRRTCDSVISQRILILTSDLSEGFLKSALERMGHKVTVLVIYKTVILDIPPMPQLDNITA
AFVTSGSIAQGIAKTGLFFDLPLVCIGHKTAEICQRSGLRVASIARTKNKEGLVQALFEL
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgagacactcttgccaccatgtatggattacccgaggcgggcaatgggcgcgcgaaatt
gccggtatgctcaaagtccggggggtaacgagtgttgtacatcccgtgattgattgtgtg
ccagtaatgggctatgaaaatgaactccagaaaattccattttttgactggcttattgtg
acaagttcgactactgcaggattgctcaatacccctattcctcagtccgtcaaggtggct
gcagttgggagggaaactgccgagtctctgatccgtgctgggcacagagtttctttgtgc
cccgaaaatgattttagttcagatgggcttgcaagcgccatacaggcccatctgaatttt
ccgcgcagaacgtgtgacagtgtcatttcgcagcgtattctgattctgacatcggatctt
tctgaaggtttcctaaaaagtgcactcgagcgtatgggacataaagtaacagttctggtt
atatataaaacagttatcttggatattccgccaatgccgcagttagacaacatcactgca
gcgtttgtgacaagtggaagtatcgcgcagggcatagccaaaacaggcctgttttttgat
ttgccacttgtgtgtataggtcacaagacagccgaaatttgtcaacgcagcgggctgcga
gttgcttcaattgcaaggactaagaataaagagggtcttgtacaggcgctttttgaactg
agttag

DBGET integrated database retrieval system