KEGG   Thermoanaerobacterium xylanolyticum: Thexy_0048Help
Entry
Thexy_0048        CDS       T01505                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:txy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Thexy_0048
DNA repair and recombination proteins [BR:txy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Thexy_0048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
56122..56721
Genome map
AA seq 199 aa AA seqDB search
MNVYSRSLSRLIDELSRLPGIGRKTAQRLAFYILDMPLDDVVNLSNAILEAKNNLRYCKK
CYNFTDSELCSICSDETRDTHTICVVSDPKDVVAMEKTREYRGLYHVLHGAISPMDGIGP
EDIKIKELLERIKDAEINEIILATNPDIEGEATAMYIAKLIKPFGIKVTRIAHGVPVGGD
LEYTDSVTLSRALEGRREM
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtatattcgaggtcattgtcaaggcttattgatgaattatcaagactccccggc
attggacgcaagacagctcagagactggcgttttacatcttagatatgcctttagatgat
gttgtcaatttgtctaatgctattttagaagcaaagaacaatttaagatactgtaaaaag
tgctataactttactgacagtgagctttgcagtatatgcagtgacgagacgagggataca
cataccatatgtgtagtttccgatcctaaagacgtagtagcgatggaaaagacgagggaa
tatcgaggattataccatgtacttcacggtgcaatatcgcctatggatggaatagggcca
gaggatataaagataaaagagctgttggagaggataaaagatgctgaaatcaatgaaata
atattagctacaaatccagatatagaaggcgaggcaactgccatgtacattgcaaagctg
ataaaaccttttggaataaaggtaacaagaattgcacacggtgtaccagtaggcggtgac
ctcgaatacacagattctgtaacactgtccagagctttagaaggcagaagggaaatgtaa

DBGET integrated database retrieval system