KEGG   Thermoanaerobacterium xylanolyticum: Thexy_0279Help
Entry
Thexy_0279        CDS       T01505                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:txy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Thexy_0279
Enzymes [BR:txy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Thexy_0279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
295805..296371
Genome map
AA seq 188 aa AA seqDB search
MIDKEKIKKAVYDILEAIGEDPKREGLLETPDRVARMYEEIFSGLHENVMDVIKTFKEDE
HQEIVIVKDIPMYSMCEHHLLPFIGVAHVAYLPRKGTILGLSKLARIVDILAKKPQLQER
LTSEIADTIVKAANPLGVAVVVEAEHLCMTMRGIKKPGAKTVTSALRGLFKTDQRSREEV
MLLINGKR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgatagataaagagaagataaaaaaagcagtgtatgatattcttgaagcgataggtgaa
gatcctaaaagagaaggactgttagagacacccgatagggttgccaggatgtacgaagaa
attttttcaggccttcatgaaaatgtgatggatgtaataaagacatttaaagaagacgag
catcaagaaatagttattgtaaaagatattccaatgtactccatgtgtgagcatcatttg
cttccgtttataggtgttgcccatgtggcgtatctaccaagaaaaggcacaatcttggga
ctttcaaagcttgccagaatcgtcgatattttagccaaaaagcctcaactgcaggagagg
cttaccagcgagatcgctgacacgattgtaaaagctgcaaatcctttaggggttgcagtc
gtcgtagaagcggagcacctttgcatgacgatgcggggtataaaaaaacctggagccaag
actgtaacatctgcacttaggggattatttaagacagatcaaaggtcaagagaggaagtc
atgctcttgataaatggaaagcgatga

DBGET integrated database retrieval system