KEGG   Thermoanaerobacterium xylanolyticum: Thexy_0311Help
Entry
Thexy_0311        CDS       T01505                                 

Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:txy00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Thexy_0311
Enzymes [BR:txy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Thexy_0311
Amino acid related enzymes [BR:txy01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Thexy_0311
Transfer RNA biogenesis [BR:txy03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Thexy_0311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
329742..331199
Genome map
AA seq 485 aa AA seqDB search
MEKRVRFAPSPTGAIHIGNIRTALFNYLFSRSEGAKLILRIEDTDLTRSSKDFEKLIFKE
LSWLGIEWDEGPDKPGEYGPYRQSERLHIYNEYAEKLIKEGKAYRCYCTPEELDKDREES
VKRGDIPRYSGRCRHLTKEQEEEYLRQGRKPSIRFIIPDDVTISFDDMIKGKIEINSDTL
GGDMIIVKSDGMPTYNFAVVVDDTLMKITHVIRGEDHIYNTPKQLLIYEALGFKPPVFAH
APLILGPDRTKLSKRHGNTYIGQYREMGYLPEAMFNFLSLLSWSPDDNVELMSKDEIIKK
FNFNKIHSANPVFDIEKLNWMNQHYIQMSPIERIVDLSLPHLKEAGYIGENVDEAKYEWL
KKVVSLFKDGLHYVAELKDKAKMFFVDDFEYNSEVKETLLSSDAKNVLTAFKEEIENMDE
VTEEGIKELLKMLQKKIGVKGKAFFMPIRFALTGQDHGPELVMIIPLLGKHKILQRIDKA
LKLIS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagagagttaggtttgcaccaagccctactggtgctattcacataggaaatatc
cgcactgcgctatttaattatttattttcaagaagtgaaggcgctaagcttatattgagg
atagaagatacggatttaacgaggtcttctaaggactttgaaaagttgatattcaaagag
ttaagctggcttggcatagaatgggatgaagggcctgacaaacctggtgaatacggacca
tacaggcaaagcgaaaggcttcacatatacaatgaatacgcagaaaagcttataaaagaa
ggcaaagcctacagatgttactgtactcctgaagagctggataaagacagagaggaatct
gttaaaagaggagatataccgaggtattcgggaaggtgtcggcatttgactaaagaacag
gaagaggagtatttgcggcaaggaaggaaaccttccattagattcataattcctgatgat
gttacaatatcatttgatgatatgataaagggaaagatcgaaattaactcagacacgctt
ggcggtgacatgataatagtaaaatctgacggcatgccaacttataactttgcagtcgtt
gtagatgatactcttatgaaaataacccatgtcataagaggtgaagatcatatctataac
acacctaagcagcttcttatttacgaagcacttggctttaagccacctgtatttgctcat
gcgcctcttatcttgggaccagacaggactaagctttctaaaagacatgggaatacttac
attggacaatacagggaaatggggtatttacctgaagcgatgtttaactttttgtcgctt
ttaagttggtctccagatgacaatgttgaattgatgtctaaagatgaaataattaaaaaa
tttaatttcaataagattcacagtgctaatcctgtttttgacatagaaaaattgaattgg
atgaatcaacattacattcagatgagtcctattgaaagaattgtagatttaagcttgcca
catcttaaagaggcaggttatattggcgaaaatgtggatgaggctaagtacgaatggcta
aaaaaggttgtttcactttttaaagatggcttgcactatgtggctgaactgaaagacaaa
gcaaagatgttctttgttgatgattttgaatacaatagcgaagtaaaagaaactttgctg
tcaagtgatgctaagaatgtactgacggcgtttaaagaggaaattgagaatatggatgaa
gttacagaagagggcataaaagaactgctaaagatgttgcaaaagaagataggagttaaa
ggaaaagcgtttttcatgcctataagatttgctttaacagggcaagatcatgggcctgaa
cttgtgatgataattcctcttttaggcaaacataaaatattgcaaaggatagataaagcc
ttaaagttaatatcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system