KEGG   Thermoanaerobacterium xylanolyticum: Thexy_0372Help
Entry
Thexy_0372        CDS       T01505                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:txy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Thexy_0372
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thexy_0372
  Lipid metabolism
   00071 Fatty acid degradation
    Thexy_0372
  Amino acid metabolism
   00350 Tyrosine metabolism
    Thexy_0372
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Thexy_0372
   00626 Naphthalene degradation
    Thexy_0372
Enzymes [BR:txy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Thexy_0372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
379284..380465
Genome map
AA seq 393 aa AA seqDB search
MKTNFTYFMPTEIIFGPGTLEKLATVKLPGKKALLVIGNGNSMRKHGYLDRVVNYLKQNG
VDYVVYDKILPNPIAEHVAEGAKVAKDNGCDFVIGLGGGSTIDSSKAIAVMAKNTGDYWD
YVSGGSGKGMEVKNGALPIVAIPTTAGTGTESDPWAVVTKTETNEKIGFGCKYTYPTLSI
VDPELMVSIPPKFTAYQGMDAFFHSVEGYLATVNQPGSDVLALQSISLITENLPKAVEDG
SDIEARTALAWASTAAGIVESLSSCISHHSLEHALSAYHPEIPHGAGLIMLSVSYFSFMA
SKAPERFVDIARAMGEEIVGDTVEEQAMCFINGLKKLIKNIGMEDLSLSSFGVTEDEATK
LGKNAMDTMGGLFNVDPYKLSLDEVVSIYKNCF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactaattttacttattttatgccaacagaaattatttttggaccaggtacactg
gaaaagttggctaccgttaaattgccgggcaagaaagccttattggtcataggtaatggc
aattcaatgagaaagcatggttatctggatagagttgttaattacttaaagcaaaatggt
gttgattatgtcgtttatgataagatattacctaatccaatcgcagagcatgttgcggag
ggagcaaaagtagcaaaggacaatggatgcgattttgtcataggattaggaggcggtagc
acaatagattcatcaaaagcaatagctgtgatggctaagaatacaggtgattattgggat
tatgtttcaggtggcagcggaaaaggaatggaagttaaaaatggtgcattgcctatcgtt
gctattcctacgactgccggtactggcacagagtctgatccgtgggctgtcgtgacaaag
acagagacaaatgagaagattgggtttggatgtaagtatacatatcctacactttccatc
gttgatcctgaattgatggtttcaattccaccgaaatttactgcttatcaaggcatggat
gcatttttccactctgtggaaggatatttggcaactgtcaaccagccaggaagtgatgtt
ttagcacttcaatccataagtcttattactgagaatcttcctaaagctgtagaagatggc
agtgatattgaggctcgcacagcgttagcgtgggcaagtactgctgcaggtatagtagaa
tcattgtcatcatgcatttcccatcattcgttagaacatgctttaagtgcataccatcca
gagataccacatggtgctggacttataatgctttcggtgtcttactttagcttcatggct
tcaaaagctcctgaaaggtttgtagatatagcaagagcaatgggcgaggagatagttgga
gatactgtagaagaacaagccatgtgttttataaacggtcttaaaaaattgattaaaaat
ataggaatggaagatttaagtttgtcaagctttggagtaactgaggatgaagctacaaaa
ttagggaaaaatgctatggatacaatgggtggcttgtttaatgtggatccatacaagcta
tcattagatgaggtagtatccatatacaaaaattgtttctaa

DBGET integrated database retrieval system