KEGG   Thermoanaerobacterium xylanolyticum: Thexy_0481Help
Entry
Thexy_0481        CDS       T01505                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:txy00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
497361..498851
Genome map
AA seq 496 aa AA seqDB search
MSKYIMALDQGTTSSRAIIFDHSGNIVASLNKEFTQIYPNPGWVEHDPMEILDSQIEVAK
AVLEKTGIKAEDIAAIGITNQRETTVVWDKNTGKPVYNAIVWQCRRTAPICDEIKNSGFD
KEILKKTGLVVDAYFSGTKIKWILDNVEGAREKAENGDLYFGNIDSWLIWNLTGGKAHVT
DYSNASRTMLFNIYELKWDKDILEYLDIPESMLPDVKPSSYVYGYTDKSIFGVEIPIAGC
AGDQQAALFGQTCYDKGMAKNTYGTGCFMLMNTGERAVPSKNGLLTTIAWGIDDKVEYAL
EGSIFIAGAAIQWLRDELKIIDNSPQSEEYAQRVSDTNGVYVVPAFVGLGAPYWDMYARG
AILGLTRGVKREHIIRATLESLAYQTRDVLEAMQDDSGIKLSALKVDGGASANNFLMQFQ
ADILGVPVDRPTVIETTALGASYLAGIATGFWSGREEVAKNWGVDRHFEPNMNDETREKL
YAGWKKAVERSMNWAD
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagtatataatggcattagatcaaggcaccacaagctcaagggcaataatcttt
gatcacagtggaaatatagttgcatcactaaacaaagagtttacgcagatttaccctaat
ccagggtgggttgaacacgaccctatggagattttagattctcagatagaagtagctaag
gcggtgcttgagaaaactgggattaaggcagaagatattgcagcaatcggcataacaaat
caaagagagacgactgtggtttgggataaaaacacaggcaagccagtgtacaatgcgata
gtttggcagtgtaggaggactgcacctatctgcgatgaaatcaaaaatagtgggtttgac
aaagaaattctaaagaagactggtcttgtagttgatgcttatttttcgggtacgaagata
aaatggatacttgacaatgtagaaggtgcaagggagaaagcagaaaatggagatctttac
tttggaaatattgatagctggttaatttggaatttgactggtggaaaggcacatgtgaca
gactattctaatgcttctcgtacgatgctttttaacatatacgaattgaagtgggataag
gacatattagaatatcttgacattccagaatcgatgcttcctgatgttaagccgtccagt
tatgtatacggatacacggacaaaagcatatttggcgttgaaatacctatagcaggttgc
gcaggtgaccaacaagcagcactatttggtcagacttgttatgacaaaggaatggctaag
aatacttatggaaccggatgctttatgcttatgaatacaggcgaaagggctgtgccatcc
aagaatggtttgcttaccacgatagcgtggggtatcgatgataaagttgaatatgcttta
gaaggaagcatattcatagctggtgctgctatacagtggctaagagatgagcttaagata
attgacaattcaccgcaaagtgaagaatacgctcaaagggtcagtgacacaaatggagtg
tacgttgtgccggcatttgtgggattaggtgcaccatactgggatatgtatgcaaggggc
gcgattttgggcttgacaagaggtgtgaaaagagagcacattataagagcaacgttagaa
tctttggcgtatcagacgagagacgtcttagaggctatgcaggatgattctggtataaag
ttaagtgcattaaaggttgacggtggagcatctgcaaataatttcttgatgcagttccag
gcagatatattaggtgtacctgtagatagacctactgtcatagagacgactgcattaggt
gcatcatatcttgcaggtattgctacaggattctggagtggcagagaagaagtagctaag
aattggggagttgacagacatttcgagcctaacatgaatgatgaaacaagagaaaaactt
tatgcgggatggaaaaaagccgtagaaaggtctatgaattgggctgattaa

DBGET integrated database retrieval system