KEGG   Thermoanaerobacterium xylanolyticum: Thexy_0534Help
Entry
Thexy_0534        CDS       T01505                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
txy00010  Glycolysis / Gluconeogenesis
txy00052  Galactose metabolism
txy00500  Starch and sucrose metabolism
txy00520  Amino sugar and nucleotide sugar metabolism
txy00521  Streptomycin biosynthesis
txy01100  Metabolic pathways
txy01110  Biosynthesis of secondary metabolites
txy01120  Microbial metabolism in diverse environments
txy01130  Biosynthesis of antibiotics
txy01200  Carbon metabolism
Module
txy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:txy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thexy_0534
   00052 Galactose metabolism
    Thexy_0534
   00500 Starch and sucrose metabolism
    Thexy_0534
   00520 Amino sugar and nucleotide sugar metabolism
    Thexy_0534
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thexy_0534
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Thexy_0534
Enzymes [BR:txy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Thexy_0534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Pan_kinase Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: AEF16585
JGI: Thexy_0534
UniProt: F6BHK4
Position
557459..558394
Genome map
AA seq 311 aa AA seqDB search
MRIGVDIGGTNIAVGLVDMDGKIVATGSRPAEPKRGYAAIAKDIAEISLELVKRCGLDVS
QIESMGIGVPGVADNEKGIVLRAVNLYWTKVPLVKEIHKYIDVPINMDNDANVAALAEGV
FGAGRGTNSSVTITLGTGVGSGFILNGKVFNGSHHFAPELGHIVIGDNGVLCNCGKVGCL
ETFASATALIREGKKAVMKNSDSLILKLAGGEIESITAKNVIDAARQFDETAMLIFNDYV
KYLAIGIVNIINILDPEVVIIGGGVANAGDFLLKPLKEEVSKNILFKDLPYADIRKAELG
NDAGIIGAAIL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagaattggcgttgatataggaggaacaaacatagctgttgggttagtcgacatggat
gggaaaatagtagcgacaggatcgagacctgcagagcctaaaagaggttatgctgctatt
gctaaagacattgctgaaatttcgctggaacttgtgaaaaggtgtgggcttgacgtatct
caaattgagtcgatgggtattggtgttcctggtgttgctgataacgaaaaaggtattgtc
ttaagagctgtgaatttatattggacaaaggtgccattagtaaaggaaatacataaatac
atcgatgtgcctataaacatggacaatgacgcaaatgtagcagcgcttgcggaaggtgta
tttggagctggaagaggtacaaactcatctgttactataactttgggcacaggtgtaggt
tccggatttatattaaatggcaaagtgtttaacggttcgcaccattttgctcctgagctg
gggcacattgtgattggagacaatggggttttgtgcaattgcggtaaagtaggatgtctt
gagacttttgcgtctgcaacggcattaatcagagaaggcaaaaaggctgtcatgaaaaac
agcgattctcttatactcaaattggcaggcggagagattgagtccataacggctaaaaac
gtaattgatgctgcaaggcaatttgatgaaacagcaatgcttatatttaatgattacgta
aagtatctagcaataggaattgtcaatatcataaacatacttgatccagaagtagtcata
ataggtggcggtgttgctaatgctggtgatttccttttaaagccgcttaaagaagaagta
agcaaaaacatactttttaaagatctgccttatgctgacattagaaaagcagagcttgga
aatgatgctggaataataggcgcagcaattctttaa

DBGET integrated database retrieval system