KEGG   Thermoanaerobacterium xylanolyticum: Thexy_0534Help
Entry
Thexy_0534        CDS       T01505                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:txy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thexy_0534
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thexy_0534
   00052 Galactose metabolism
    Thexy_0534
   00500 Starch and sucrose metabolism
    Thexy_0534
   00520 Amino sugar and nucleotide sugar metabolism
    Thexy_0534
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thexy_0534
   00524 Butirosin and neomycin biosynthesis
    Thexy_0534
Enzymes [BR:txy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Thexy_0534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
557459..558394
Genome map
AA seq 311 aa AA seqDB search
MRIGVDIGGTNIAVGLVDMDGKIVATGSRPAEPKRGYAAIAKDIAEISLELVKRCGLDVS
QIESMGIGVPGVADNEKGIVLRAVNLYWTKVPLVKEIHKYIDVPINMDNDANVAALAEGV
FGAGRGTNSSVTITLGTGVGSGFILNGKVFNGSHHFAPELGHIVIGDNGVLCNCGKVGCL
ETFASATALIREGKKAVMKNSDSLILKLAGGEIESITAKNVIDAARQFDETAMLIFNDYV
KYLAIGIVNIINILDPEVVIIGGGVANAGDFLLKPLKEEVSKNILFKDLPYADIRKAELG
NDAGIIGAAIL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagaattggcgttgatataggaggaacaaacatagctgttgggttagtcgacatggat
gggaaaatagtagcgacaggatcgagacctgcagagcctaaaagaggttatgctgctatt
gctaaagacattgctgaaatttcgctggaacttgtgaaaaggtgtgggcttgacgtatct
caaattgagtcgatgggtattggtgttcctggtgttgctgataacgaaaaaggtattgtc
ttaagagctgtgaatttatattggacaaaggtgccattagtaaaggaaatacataaatac
atcgatgtgcctataaacatggacaatgacgcaaatgtagcagcgcttgcggaaggtgta
tttggagctggaagaggtacaaactcatctgttactataactttgggcacaggtgtaggt
tccggatttatattaaatggcaaagtgtttaacggttcgcaccattttgctcctgagctg
gggcacattgtgattggagacaatggggttttgtgcaattgcggtaaagtaggatgtctt
gagacttttgcgtctgcaacggcattaatcagagaaggcaaaaaggctgtcatgaaaaac
agcgattctcttatactcaaattggcaggcggagagattgagtccataacggctaaaaac
gtaattgatgctgcaaggcaatttgatgaaacagcaatgcttatatttaatgattacgta
aagtatctagcaataggaattgtcaatatcataaacatacttgatccagaagtagtcata
ataggtggcggtgttgctaatgctggtgatttccttttaaagccgcttaaagaagaagta
agcaaaaacatactttttaaagatctgccttatgctgacattagaaaagcagagcttgga
aatgatgctggaataataggcgcagcaattctttaa

DBGET integrated database retrieval system