KEGG   Thermoanaerobacterium xylanolyticum: Thexy_0816Help
Entry
Thexy_0816        CDS       T01505                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
txy00010  Glycolysis / Gluconeogenesis
txy00051  Fructose and mannose metabolism
txy01100  Metabolic pathways
txy01110  Biosynthesis of secondary metabolites
txy01120  Microbial metabolism in diverse environments
txy01130  Biosynthesis of antibiotics
txy01200  Carbon metabolism
txy01230  Biosynthesis of amino acids
Module
txy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
txy_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:txy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thexy_0816
   00051 Fructose and mannose metabolism
    Thexy_0816
   00562 Inositol phosphate metabolism
    Thexy_0816
Enzymes [BR:txy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Thexy_0816
Exosome [BR:txy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Thexy_0816
  Exosomal proteins of bladder cancer cells
   Thexy_0816
  Exosomal proteins of melanoma cells
   Thexy_0816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM MurB_C
Motif
Other DBs
NCBI-ProteinID: AEF16857
JGI: Thexy_0816
UniProt: F6BJ25
Position
864368..865114
Genome map
AA seq 248 aa AA seqDB search
MRRPIIAGNWKMYMTPSEAINLVNELKPLVSGAEAEVVVIPPFVDLIDVKKAIDGSNIKL
GAQNMHWEEKGAFTGEVSPTMLKEIGVEYVVIGHSERRQYFAETDETVNKKVKSALGHGL
KPIVCVGESLSQREAGEAFNVVREQTKKALDGIRSEDVLNVVIAYEPIWAIGTGKTATSK
DANDVIKVIRETIADIYGIDIANEVRIQYGGSVKPDNAKELMSESDIDGALVGGASLKAQ
DFAKIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
ttgagaagacctattatcgcaggtaattggaagatgtacatgacgccatctgaagctata
aaccttgtaaatgagcttaagcctttagtgtctggtgcagaagcagaagttgtagtaata
ccaccgtttgtggatcttatagacgtaaagaaggccatagatggctctaacataaagtta
ggtgcacagaatatgcactgggaagaaaaaggcgcatttacaggagaagtttcaccgact
atgctcaaagagataggtgtagagtacgtcgtaatcggccattccgagagaagacagtat
ttcgctgagacagatgagactgtgaataaaaaagttaaatctgcattaggtcatggtctt
aagcctattgtatgtgtaggcgaatcattatctcaaagagaagcaggagaagctttcaat
gtagtaagagaacagacaaaaaaagcattggatggcattagaagtgaagatgtcttaaat
gtcgtcatagcttatgagcctatttgggctattggtacaggtaaaacagctacgtcgaaa
gatgcaaatgacgtaataaaggtcataagagagactattgcagacatatacggtatagac
atcgctaatgaggtaagaatacaatatggtggcagtgttaaacctgataatgctaaagag
cttatgtcagaaagcgatattgatggtgcattagtgggcggagctagccttaaagcgcag
gatttcgctaaaattgtaaattattaa

DBGET integrated database retrieval system