KEGG   Thermoanaerobacterium xylanolyticum: Thexy_0959Help
Entry
Thexy_0959        CDS       T01505                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:txy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thexy_0959
   01230 Biosynthesis of amino acids
    Thexy_0959
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thexy_0959
   00030 Pentose phosphate pathway
    Thexy_0959
   00051 Fructose and mannose metabolism
    Thexy_0959
   00052 Galactose metabolism
    Thexy_0959
  Energy metabolism
   00680 Methane metabolism
    Thexy_0959
Enzymes [BR:txy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Thexy_0959
Protein phosphatases and associated proteins [BR:txy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Thexy_0959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1018486..1019715
Genome map
AA seq 409 aa AA seqDB search
MKSVKGNLLIAQSGGPTSVINASAYGAIKEFLSLGSGHKVYAGVYGIQGILEKRIIDIDT
LNKNTIETLKYMPSSAFGSCRYKLKDYDENEEEYEKIINIFKKFNITYFLYIGGNDSMDT
ANKLSIYMNKIGYDANIIGVPKTIDNDLVETDHCPGFGSAAKYVTNIGIEIWSDINAYKK
ESIMIMEVMGRDAGWIAASTGILKSVIPDINQLIYLPEISFDKDKFLIDVEKAIKKNNKL
LIVVSEGIKDENGEYINANKNEIDSFGHKQLGGAGRHLQNLIKENITKNVKLIELGVTQR
CAIHCASKTDIEESEIVGRDSVKYVLAGYSGYMTALERSSNDKYNCVTKLVKLQDVCKRV
KNVPLNWINEQKNSVKDAMIDYIQPLILGEINPFNENGLVKYTDINFFR
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcagttaaaggcaatttattaatagcacagtctggaggaccaacaagcgttata
aatgcatcagcatatggagcaattaaagaatttttatcattgggaagtggtcataaagtt
tatgctggtgtatacggtatacaaggtatattagaaaaacgcattattgatattgatact
ttgaataaaaatacaatagaaactcttaaatatatgccatcgtctgcttttggttcttgt
agatataagttaaaagactatgatgaaaatgaagaagaatatgaaaaaataataaatatt
tttaagaaatttaatataacatattttctttatattggtggaaatgactctatggataca
gctaataaattaagtatttatatgaataaaataggctacgatgctaatataatcggagtg
ccaaaaaccattgacaatgatcttgttgaaactgatcactgtcctggttttggtagtgct
gcaaagtatgttactaatataggtattgaaatatggtctgatataaatgcatataaaaaa
gagtcaattatgataatggaagtaatgggaagagatgctggatggatagctgcctcaaca
ggcattttaaaaagcgtaataccagatataaatcaacttatttatttaccagaaataagt
tttgataaagataaatttttaattgatgtagaaaaagcaattaaaaaaaataacaaactt
ttaattgtagtttcggaaggcataaaggatgaaaatggtgaatacattaatgcaaataaa
aacgaaatagattcttttgggcataaacaacttggtggagcgggtagacatctacagaat
ttaataaaagaaaatattacaaagaatgtaaaattaattgaattaggagtaacacaaaga
tgtgccatacattgtgcatctaaaactgatatagaagagtctgaaatagttggtagagat
tcggtaaagtatgttcttgcggggtatagtggatatatgacagctttagaaagatcaagt
aatgataagtataactgtgtaacaaaattagtaaaacttcaagatgtatgcaaaagggta
aaaaacgttcctttaaattggataaatgaacagaaaaatagtgtgaaagatgcaatgata
gattatatacagccacttattctaggagagattaatccttttaatgaaaatgggttagta
aaatatacggatattaatttttttagataa

DBGET integrated database retrieval system