KEGG   Thermoanaerobacterium xylanolyticum: Thexy_1049Help
Entry
Thexy_1049        CDS       T01505                                 

Definition
cysteine desulfurase (EC:2.8.1.7)
Orthology
K04487  
cysteine desulfurase [EC:2.8.1.7]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Thiamine metabolism
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:txy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Thexy_1049
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    Thexy_1049
Enzymes [BR:txy01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     Thexy_1049
Transfer RNA biogenesis [BR:txy03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    Thexy_1049
 Prokaryotic Type
    Thexy_1049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1124285..1125439
Genome map
AA seq 384 aa AA seqDB search
MEVYLDNSATTKVRREVAEKMVEVMEVEYGNPSSVHRKGYNAEKILSKSREDVAKLLGGA
SDEVFFTSGGTESNNLAIRGIVHSMKRYGNHLITTKIEHPSVLNVMKQLEEEGFDVTYLN
VDKQGYVDLDELKNVINDRTILMSIMAVNNEIGTIEPLDEIAKLKQMKDKFYFHVDGVQA
IGKINIDLRNINIDLLSLSGHKMHGPKGIGALYVKKGTKIKPILYGGGQEANLRSGTENM
PGIVGLGEACLLINDNFLEYEAKLKTLKRKLYDGIKNEIPDIHLNGPDIDDGAPQILNVS
FLGVRGEVLLHALEDKGIYVSTGSACSSHKNTESHVLKAIGLSSEYIEGAIRFSLSVFNT
DEEIDYTVDVLKEKVKFLRRYKRR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggaggtatatcttgacaatagcgccacgacgaaagttcgtagagaagtagctgaaaaa
atggttgaagtaatggaagtcgaatatggcaatccatcgtcggtacatcgtaaaggatat
aatgcagaaaagatattgtctaagtcaagagaagatgtagcgaaattattggggggtgca
tcagatgaagtatttttcacatcaggtggaactgaatcaaataatttggctatacgcggc
attgtacatagcatgaagcgatatggcaatcatctgataaccacaaagattgagcatcca
tctgtattgaatgtcatgaagcagcttgaagaagaaggttttgatgtcacttatctcaat
gtagataaacaaggatatgtagacttagatgagttaaaaaatgtcataaatgacaggacg
attttgatgtctataatggctgtcaacaatgagataggcactatagaaccattggatgag
attgccaaattaaaacaaatgaaagataaattttattttcatgttgatggtgtacaggca
attggaaaaattaatattgatttaaggaatattaacatagaccttttgtctttaagcggc
cataaaatgcatgggccaaagggcataggagctctatacgtaaaaaaagggactaaaatt
aaacctattttgtacggtggagggcaggaagccaatttaaggtcaggaactgaaaacatg
ccaggcatcgtaggacttggagaagcatgtctattgataaatgataattttcttgaatac
gaggctaaacttaaaacattaaagagaaaattgtacgatggtataaaaaacgagattcct
gatattcacttaaatggccctgacatcgatgatggtgcaccgcaaatattaaatgtatct
tttttaggtgtaagaggtgaagtattgcttcatgctttggaagacaagggtatatatgtg
tcaactggttctgcttgttcatcccataaaaatactgaaagccatgtattaaaggctatt
ggattaagtagcgaatatatagaaggtgctattaggttttccttaagtgtatttaataca
gatgaagaaatagattatacggttgatgtattaaaggagaaagtgaaatttttaaggaga
tacaaaaggaggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system