KEGG   Thermoanaerobacterium xylanolyticum: Thexy_1059Help
Entry
Thexy_1059        CDS       T01505                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:txy00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Thexy_1059
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Thexy_1059
Enzymes [BR:txy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Thexy_1059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1135247..1136713
Genome map
AA seq 488 aa AA seqDB search
MRLVDILKDVNYTTVKGNIDVDVKGICYDSRNSKEGSLFVAIKGFKFDGADYINDAVERG
AVAIVVEREVSIDKDITVIKVENARKSLAKIASNYYGDPSKQLFMIGVTGTNGKTSVTYM
IKSILESQNNKVGLIGTIHNMIGDKVYPTERTTPESLDLQRYLRLMVDEGVKYVVMEVSS
HSLALNRVDECKFDIAVFTNLTQDHLDFHKTMDEYANAKAKLFRMAKTACVINIDDDYSS
YMIENSNAKVVTYGIKDYAYIMAKDIKNDIKGAKFTVQIEDIKSEIALKIPGLFSVYNSL
AAISVAFILGIPLQSVKMALKDVKIKGRFEVLDLDVPYNVVIDYAHTPDGLENLMKAFGE
YNTGKKILLFGCGGDRDKGKRPKMGEVAGKYADFVIITSDNPRSEEPIKIIQEIEEGIKN
TKCPYTIIEDRKEAIKYALSIAKDNDVVILAGKGHETYQVLKDKVIDFDERDIVRDILNG
DEKVDFNS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagacttgtggatatattaaaggatgtaaattatacaacggttaaaggcaacatcgat
gttgatgtaaaaggcatttgctatgattcgagaaattcgaaagaaggttcgctatttgtc
gcaatcaaaggatttaagtttgatggcgcggattacataaatgatgctgtagaaagagga
gctgttgccattgtagttgaacgtgaagtaagcatagataaagacatcaccgtcataaaa
gtagaaaatgccaggaagtcattggctaaaatcgcatcaaattattatggagatccttca
aagcagctttttatgataggcgtgacaggaacaaacggcaaaacttctgtcacatacatg
ataaagtccatactggaaagccagaacaataaagtcgggttgataggaacgattcacaac
atgattggcgataaagtttatccaactgagaggactacgccagagtcattagatcttcaa
cgataccttaggctcatggttgatgaaggtgtgaaatacgtagtgatggaagtttcttca
cattcattggcgttaaacagagtagatgaatgcaaatttgacatagctgtttttacgaat
ttaacccaagaccatttagattttcataagacgatggatgaatatgctaatgcaaaggct
aaactttttagaatggcaaagacagcttgcgtgataaacatagatgatgattattcttcg
tatatgatagagaattctaatgctaaagttgtaacatatggtataaaagactatgcatac
ataatggcaaaagatatcaaaaacgatattaaaggtgcgaaatttaccgttcagatagaa
gatataaaaagtgaaatagccttaaagataccgggactatttagtgtttacaattcactg
gcggctatttcagtagcatttatattgggtataccgcttcagtctgtgaaaatggctctt
aaggatgtcaagataaaaggcagatttgaagttcttgatttggatgtaccttacaatgta
gttattgactacgcccacactccggacggacttgagaatttgatgaaagcatttggtgaa
tacaatactgggaaaaagatattgctttttggttgtggaggtgacagagataaaggcaaa
cgccctaaaatgggagaagtcgctggcaaatatgctgattttgtaattataacttcggac
aatccaaggtcggaggagcctattaagataatacaagaaattgaagaaggcattaaaaat
acaaaatgtccttacacaatcatagaagataggaaagaggctataaagtacgcactatct
atagcgaaggacaatgacgtcgtaattttagctggtaaaggtcatgaaacatatcaagta
ttgaaagacaaagtcatagattttgatgaaagagacatagtaagagatatattaaatgga
gatgaaaaagttgattttaacagttaa

DBGET integrated database retrieval system