KEGG   Thermoanaerobacterium xylanolyticum: Thexy_1169Help
Entry
Thexy_1169        CDS       T01505                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:txy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thexy_1169
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Thexy_1169
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Thexy_1169
Enzymes [BR:txy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Thexy_1169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1242025..1243119
Genome map
AA seq 364 aa AA seqDB search
MKIVVKIGTSTLTYENGKLNLEMMEKIVRQISNLQNKGDKVVLVTSGAIGAGMGKLNILK
RPKTLPEKQSLAAIGQGLLIGLYEKFFNEYGKTTAQLLLTRDDFSIRERYLNISYTLSNL
LRYNVVPIINENDTVTVDEIKIGDNDTLSALVASIIEADLLIILTDIEGLYDRDPKVDGA
KLIDVVHDFSDALFEIAGGSGTNFGTGGMYTKIQAAKICYNAGVQMVIANGKLDNVLNKI
AAGERIGTVFMPAKNPISNRKVWIAFNAQLSGKLIIDGGARQAILENGKSLLPSGIISTD
GEYSVGDCVSIYDKDGKEIARGLINYTSDEVNKIKGLKSTDIDKVLGYKNYDEVVHRDNL
VVIV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgtcgtgaaaatcggaacaagtacattgacttatgaaaatggaaagttgaat
ttagagatgatggaaaaaattgtacgacaaatatctaatttacaaaataaaggcgataaa
gttgttcttgtgacatctggtgccattggagctggaatgggcaaactaaatattttgaaa
agacctaaaacattgccggaaaaacaatcattggcggcaattggacaaggattgctaatc
ggactgtatgaaaaattttttaatgaatatgggaagactacagctcagctattgcttaca
agggatgatttttctataagagaaaggtatttaaacataagctatacattatcaaattta
ttaaggtacaatgtagtcccaatcataaacgaaaatgatactgttactgtagatgaaata
aaaataggagataatgatacgctatcagcgcttgtagcaagcatcatagaagcggatcta
ttaattatattgactgatattgaggggctatatgatagagaccctaaagtagatggagct
aagctgatagatgtggttcatgatttttctgatgcgctttttgaaattgctggaggttct
ggtacaaattttggcacgggtggtatgtatacaaagattcaagcagcaaaaatttgttac
aacgcaggtgtccaaatggtaattgccaatggcaagcttgataatgttttaaataaaatt
gcagcaggtgaaagaatagggacagtttttatgcctgctaaaaatcctatcagcaataga
aaggtttggatcgcatttaatgcacaattgtcaggtaagctaattattgacggtggggca
agacaggccatacttgaaaatggaaaaagtctattgccaagtggtattatatcaactgat
ggagaatattctgtaggggattgtgtgtcaatatatgataaggatggaaaagagattgca
agaggtttgattaattatacatctgatgaagttaacaaaataaaaggtttaaaatcgacc
gatatagacaaagttttaggatataaaaattacgatgaagtcgtccacagagacaattta
gttgtcatagtttga

DBGET integrated database retrieval system