KEGG   Thermoanaerobacterium xylanolyticum: Thexy_1227Help
Entry
Thexy_1227        CDS       T01505                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:txy00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1288950..1289816
Genome map
AA seq 288 aa AA seqDB search
MIIKDNLSNGGKFLGSNDDYYKSEIVIVGAPMDYTVSFKPGTRFGPQAIRMASLGLEEYS
VYLDRSLKDKKYYDYGDLILPYGNVEKCLNIIGDAAKDIIDAGKKPIFLGGEHLISAPIL
EKVFKKYGNELVVLHFDAHTDLRTEFFGERDSHATVLRIASEFVNKKNMYHFGIRSGVKE
EFVFAFKNTNMFLYDVVEPLKSILDNIKSKPIYITWDIDVLDPAFAPGTGTPEPGGITSK
EALSAIHMLKDLNVVGMDLVEVSPDYDHSGITSILAAKLIRESILSFL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttgataataaaagacaatttatcaaacggtggaaaatttttaggaagcaacgatgattat
tataaatctgaaattgtgattgtaggtgctcctatggattacactgtaagctttaaacct
ggtacacgctttggaccacaggcaataaggatggcgtctttaggattagaagagtacagt
gtatatttggatagaagtttaaaagacaaaaagtattatgattatggtgatttgatatta
ccttatggaaatgtagaaaaatgtttaaatataattggtgatgctgctaaagatattata
gatgctgggaaaaagccgatatttttgggtggtgagcatttaataagtgctccaatctta
gaaaaagtttttaaaaagtacggaaatgagttagttgtgcttcactttgacgcacataca
gatttgagaactgaattttttggagaaagagattcccatgccacagttttaagaatagcc
tctgaatttgtaaacaaaaaaaatatgtatcattttggtatacgctcaggtgttaaagag
gaatttgtattcgcgttcaaaaataccaatatgttcttatatgatgttgttgaacctttg
aaatcaatacttgataatataaaatcaaagcctatatatatcacatgggacatagatgtt
ttagatcccgcttttgcacctggtaccggtactcctgaacccggcggtataacctcaaaa
gaagcgctaagtgcaatacacatgttgaaagatctaaatgttgtaggtatggatctggtt
gaggtatcgcctgattacgatcattcaggtataacatcgattttagctgcaaaattgatc
agagagtctattctatcattcttatga

DBGET integrated database retrieval system