KEGG   Thermoanaerobacterium xylanolyticum: Thexy_1227Help
Entry
Thexy_1227        CDS       T01505                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
txy00330  Arginine and proline metabolism
txy01100  Metabolic pathways
Module
txy_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:txy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Thexy_1227
Enzymes [BR:txy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Thexy_1227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: AEF17260
JGI: Thexy_1227
UniProt: F6BLL3
Position
1288950..1289816
Genome map
AA seq 288 aa AA seqDB search
MIIKDNLSNGGKFLGSNDDYYKSEIVIVGAPMDYTVSFKPGTRFGPQAIRMASLGLEEYS
VYLDRSLKDKKYYDYGDLILPYGNVEKCLNIIGDAAKDIIDAGKKPIFLGGEHLISAPIL
EKVFKKYGNELVVLHFDAHTDLRTEFFGERDSHATVLRIASEFVNKKNMYHFGIRSGVKE
EFVFAFKNTNMFLYDVVEPLKSILDNIKSKPIYITWDIDVLDPAFAPGTGTPEPGGITSK
EALSAIHMLKDLNVVGMDLVEVSPDYDHSGITSILAAKLIRESILSFL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttgataataaaagacaatttatcaaacggtggaaaatttttaggaagcaacgatgattat
tataaatctgaaattgtgattgtaggtgctcctatggattacactgtaagctttaaacct
ggtacacgctttggaccacaggcaataaggatggcgtctttaggattagaagagtacagt
gtatatttggatagaagtttaaaagacaaaaagtattatgattatggtgatttgatatta
ccttatggaaatgtagaaaaatgtttaaatataattggtgatgctgctaaagatattata
gatgctgggaaaaagccgatatttttgggtggtgagcatttaataagtgctccaatctta
gaaaaagtttttaaaaagtacggaaatgagttagttgtgcttcactttgacgcacataca
gatttgagaactgaattttttggagaaagagattcccatgccacagttttaagaatagcc
tctgaatttgtaaacaaaaaaaatatgtatcattttggtatacgctcaggtgttaaagag
gaatttgtattcgcgttcaaaaataccaatatgttcttatatgatgttgttgaacctttg
aaatcaatacttgataatataaaatcaaagcctatatatatcacatgggacatagatgtt
ttagatcccgcttttgcacctggtaccggtactcctgaacccggcggtataacctcaaaa
gaagcgctaagtgcaatacacatgttgaaagatctaaatgttgtaggtatggatctggtt
gaggtatcgcctgattacgatcattcaggtataacatcgattttagctgcaaaattgatc
agagagtctattctatcattcttatga

DBGET integrated database retrieval system