KEGG   Thermoanaerobacterium xylanolyticum: Thexy_1434Help
Entry
Thexy_1434        CDS       T01505                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:txy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Thexy_1434
Enzymes [BR:txy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Thexy_1434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1492325..1492885)
Genome map
AA seq 186 aa AA seqDB search
MIDYIKGHIVEKGIDYVVIETLGIGFKIIVPRSTLSHLTNTSEIIKLYTYMHVKEDGFQL
YGFLTTNEVEIFKKLIAVNGVGPKAAVSILSTISIEGFYDAIRNSDSKAIEKSPGIGKKT
AQRIILELKDKLTFAHDVKLDDLSNDVVDALLSLGYTKQESIKALEGVDCSNLESALKEA
LKKLMK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgatagattacataaagggtcatattgttgaaaaaggcattgactacgttgttattgaa
acgcttggcataggttttaaaataatagtgccaaggagcactttaagtcacttgacaaat
acaagtgagataattaagctttatacatatatgcatgttaaagaggatggatttcaactt
tatggatttttgacgacaaatgaagtggagatttttaaaaaattgatagctgtaaatggc
gttggacctaaagcagcagtttcaatattgtcgacaatttccattgaaggtttttatgat
gccataagaaacagcgattcaaaggctatagaaaagtcaccaggcattggcaaaaaaact
gcacagcggattatattggagcttaaagacaagttaacatttgctcatgatgtaaaactt
gatgatttgtcaaatgatgtggttgatgcgctgttatcacttggatatacaaaacaagag
tctataaaagcattagagggagtggactgttcaaatttagagtctgctttaaaagaggca
ttgaaaaagcttatgaaataa

DBGET integrated database retrieval system