KEGG   Thermoanaerobacterium xylanolyticum: Thexy_1467Help
Entry
Thexy_1467        CDS       T01505                                 

Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:txy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thexy_1467
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thexy_1467
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thexy_1467
Enzymes [BR:txy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thexy_1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1519453..1520274)
Genome map
AA seq 273 aa AA seqDB search
MLSSVEVNNLRENRIDKKFNELKKKGRKALITFITAGDPDIDVTINLVYKMVESGADIIE
IGIPYSDPLADGPIIQASSARALKKGTKIDNIMNAVKIIRQNTDVPLVYLVYYNSIYKYG
IEKFLKNAKESGVDGLIIPDLPLEERKDIKELSEKHHVYLIPLVAPTSNDRIKKICENGK
GFVYCVSTKGVTGVRNSIETDIEKYMHLVSKYTNLPKAIGFGISGPEMAKKFAPYCDGII
IGSAIVKMINDSRNNDEIFNSVINFISSVKDVI
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcaagtgtggaagttaacaacttaagagaaaacaggattgataaaaaattcaat
gaattaaagaaaaaaggacgaaaagcactaattacatttataactgctggagatcccgat
atagatgtaaccatcaatttagtgtataaaatggtcgaaagtggagctgacattatagag
atcggaattccatattcggacccgctggcagatggacctataatacaagcttcatctgcc
agagcgctgaaaaaaggtactaaaatagataatataatgaatgctgttaaaataataaga
caaaatacagatgtaccgcttgtgtaccttgtttattacaattccatctataaatatgga
attgaaaaatttttaaagaatgcaaaagaatcaggtgtagatggactaattatacccgat
ttgccactggaggaaagaaaagacataaaagaattatctgaaaaacaccatgtttatttg
ataccgttagttgcacctacttcaaatgacaggataaaaaagatttgtgaaaacggaaaa
ggctttgtgtattgtgtttccacaaaaggcgttacaggtgtgaggaattctattgaaact
gatattgaaaagtacatgcatttggtgtcaaagtacactaatttgccaaaagcaattgga
tttggcatatctggacctgagatggcgaaaaaatttgctccgtactgtgatggaataata
attggcagtgcaatagttaaaatgataaatgattcaagaaataatgatgaaatatttaac
agtgtgataaattttatatcatcagtcaaagatgtaatttaa

DBGET integrated database retrieval system